KEGG   Escherichia coli K-12 MG1655: b4177Help
Entry
b4177             CDS       T00007                                 

Gene name
purA
Definition
(RefSeq) adenylosuccinate synthetase (EC:6.3.4.4)
  KO
K01939  
adenylosuccinate synthase [EC:6.3.4.4]
Organism
eco  Escherichia coli K-12 MG1655
Pathway
Purine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Module
Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
Brite
KEGG Orthology (KO) [BR:eco00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    b4177 (purA)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    b4177 (purA)
Enzymes [BR:eco01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.4  adenylosuccinate synthase
     b4177 (purA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Pasteur: 
RegulonDB: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Structure
PDB: 

Jmol
Position
4404687..4405985
Genome map
AA seq 432 aa AA seqDB search
MGNNVVVLGTQWGDEGKGKIVDLLTERAKYVVRYQGGHNAGHTLVINGEKTVLHLIPSGI
LRENVTSIIGNGVVLSPAALMKEMKELEDRGIPVRERLLLSEACPLILDYHVALDNAREK
ARGAKAIGTTGRGIGPAYEDKVARRGLRVGDLFDKETFAEKLKEVMEYHNFQLVNYYKAE
AVDYQKVLDDTMAVADILTSMVVDVSDLLDQARQRGDFVMFEGAQGTLLDIDHGTYPYVT
SSNTTAGGVATGSGLGPRYVDYVLGILKAYSTRVGAGPFPTELFDETGEFLCKQGNEFGA
TTGRRRRTGWLDTVAVRRAVQLNSLSGFCLTKLDVLDGLKEVKLCVAYRMPDGREVTTTP
LAADDWKGVEPIYETMPGWSESTFGVKDRSGLPQAALNYIKRIEELTGVPIDIISTGPDR
TETMILRDPFDA
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
atgggtaacaacgtcgtcgtactgggcacccaatggggtgacgaaggtaaaggtaagatc
gtcgatcttctgactgaacgggctaaatatgttgtacgctaccagggcggtcacaacgca
ggccatactctcgtaatcaacggtgaaaaaaccgttctccatcttattccatcaggtatt
ctccgcgagaatgtaaccagcatcatcggtaacggtgttgtgctgtctccggccgcgctg
atgaaagagatgaaagaactggaagaccgtggcatccccgttcgtgagcgtctgctgctg
tctgaagcatgtccgctgatccttgattatcacgttgcgctggataacgcgcgtgagaaa
gcgcgtggcgcgaaagcgatcggcaccaccggtcgtggtatcgggcctgcttatgaagat
aaagtagcacgtcgcggtctgcgtgttggcgaccttttcgacaaagaaaccttcgctgaa
aaactgaaagaagtgatggaatatcacaacttccagttggttaactactacaaagctgaa
gcggttgattaccagaaagttctggatgatacgatggctgttgccgacatcctgacttct
atggtggttgacgtttctgacctgctcgaccaggcgcgtcagcgtggcgatttcgtcatg
tttgaaggtgcgcagggtacgctgctggatatcgaccacggtacttatccgtacgtaact
tcttccaacaccactgctggtggcgtggcgaccggttccggcctgggcccgcgttatgtt
gattacgttctgggtatcctcaaagcttactccactcgtgtaggtgcaggtccgttcccg
accgaactgtttgatgaaactggcgagttcctctgcaagcagggtaacgaattcggcgca
actacggggcgtcgtcgtcgtaccggctggctggacaccgttgccgttcgtcgtgcggta
cagctgaactccctgtctggcttctgcctgactaaactggacgttctggatggcctgaaa
gaggttaaactctgcgtggcttaccgtatgccggatggtcgcgaagtgactaccactccg
ctggcagctgacgactggaaaggtgtagagccgatttacgaaaccatgccgggctggtct
gaatccaccttcggcgtgaaagatcgtagcggcctgccgcaggcggcgctgaactatatc
aagcgtattgaagagctgactggtgtgccgatcgatatcatctctaccggtccggatcgt
actgaaaccatgattctgcgcgacccgttcgacgcgtaa

DBGET integrated database retrieval system