KEGG   Escherichia coli K-12 MG1655: b4179Help
Entry
b4179             CDS       T00007                                 

Gene name
rnr
Definition
(RefSeq) exoribonuclease R, RNase R (EC:3.1.-.-)
  KO
K12573  
ribonuclease R [EC:3.1.-.-]
Organism
eco  Escherichia coli K-12 MG1655
Pathway
RNA degradation
Brite
KEGG Orthology (KO) [BR:eco00001]
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    b4179 (rnr)
Enzymes [BR:eco01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.-  Acting on ester bonds
    3.1.-.-  
     b4179 (rnr)
Messenger RNA biogenesis [BR:eco03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Ribonucreases
     b4179 (rnr)
Transfer RNA biogenesis [BR:eco03016]
 Prokaryotic Type
  tRNA degradation factors
   b4179 (rnr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Pasteur: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Position
4406654..4409095
Genome map
AA seq 813 aa AA seqDB search
MSQDPFQEREAEKYANPIPSREFILEHLTKREKPASRDELAVELHIEGEEQLEGLRRRLR
AMERDGQLVFTRRQCYALPERLDLVKGTVIGHRDGYGFLRVEGRKDDLYLSSEQMKTCIH
GDQVLAQPLGADRKGRREARIVRVLVPKTSQIVGRYFTEAGVGFVVPDDSRLSFDILIPP
DQIMGARMGFVVVVELTQRPTRRTKAVGKIVEVLGDNMGTGMAVDIALRTHEIPYIWPQA
VEQQVAGLKEEVPEEAKAGRVDLRDLPLVTIDGEDARDFDDAVYCEKKRGGGWRLWVAIA
DVSYYVRPSTPLDREARNRGTSVYFPSQVIPMLPEVLSNGLCSLNPQVDRLCMVCEMTVS
SKGRLTGYKFYEAVMSSHARLTYTKVWHILQGDQDLREQYAPLVKHLEELHNLYKVLDKA
REERGGISFESEEAKFIFNAERRIERIEQTQRNDAHKLIEECMILANISAARFVEKAKEP
ALFRIHDKPSTEAITSFRSVLAELGLELPGGNKPEPRDYAELLESVADRPDAEMLQTMLL
RSMKQAIYDPENRGHFGLALQSYAHFTSPIRRYPDLTLHRAIKYLLAKEQGHQGNTTETG
GYHYSMEEMLQLGQHCSMAERRADEATRDVADWLKCDFMLDQVGNVFKGVISSVTGFGFF
VRLDDLFIDGLVHVSSLDNDYYRFDQVGQRLMGESSGQTYRLGDRVEVRVEAVNMDERKI
DFSLISSERAPRNVGKTAREKAKKGDAGKKGGKRRQVGKKVNFEPDSAFRGEKKTKPKAA
KKDARKAKKPSAKTQKIAAATKAKRAAKKKVAE
NT seq 2442 nt NT seq  +upstreamnt  +downstreamnt
atgtcacaagatcctttccaggaacgcgaagctgaaaaatacgcgaatcccatccctagt
cgggaatttatcctcgaacatttaaccaaacgtgaaaaaccggccagccgtgatgagctg
gcggtagaactgcacattgaaggcgaagagcagcttgaaggcctgcgtcgccgcctgcgc
gcgatggagcgcgatggtcaactggtcttcactcgtcgtcagtgctatgcgctgccggaa
cgcctcgacctggtgaaaggtaccgttattggccaccgtgatggctacggctttctgcgg
gttgaagggcgtaaagatgatttgtatctctccagcgagcagatgaaaacctgcattcat
ggcgatcaggtgctggctcagccgctgggtgctgaccgtaaaggtcgtcgtgaagcgcgt
attgtccgcgtactggtgccaaaaaccagccagattgttggtcgctactttaccgaagcg
ggcgtcggctttgtggttcctgacgacagccgtctgagcttcgatatcttaatcccgccc
gatcagatcatgggcgcgcggatgggctttgtggtcgtagtcgaactgactcagcgtccg
actcgccgcaccaaagcggtgggtaaaatcgtcgaagtgctgggcgacaatatgggcacc
ggcatggcggttgatatcgctctgcgtacccatgaaattccgtacatctggccgcaggct
gttgagcaacaggttgccgggctgaaagaagaagtgccggaagaagcaaaagcgggccgt
gttgatctgcgcgatttaccgctggtcaccattgatggcgaagacgcccgtgactttgac
gatgcagtttactgcgagaaaaaacgcggcggcggctggcgtttatgggtcgcgattgcc
gacgtcagctactatgtgcgtccgtcaacgccgctggacagagaagcgcgtaaccgtggc
acgtcggtgtacttcccttcgcaggttatcccgatgctgccggaagtgctctctaacggc
ctgtgttcgctcaacccgcaggtagaccgcctgtgtatggtgtgcgagatgacggtttcg
tcgaaaggccgcctgacgggctacaaattctacgaagcggtgatgagctctcacgcgcgt
ctgacctacaccaaagtctggcatattctgcagggcgatcaggatctgcgcgagcagtac
gccccgctggttaagcatctcgaagagttgcataacctctataaagtgctggataaagcc
cgtgaagaacgcggtgggatctcatttgagagcgaagaagcgaagttcattttcaacgct
gaacgccgtattgaacgtatcgaacagacccagcgtaacgacgcgcacaaattaattgaa
gagtgcatgattctggcgaatatctcggcggcgcgtttcgttgagaaagcgaaagaaccg
gcactgttccgtattcacgacaagccgagcaccgaagcgattacctctttccgttcagtg
ctggcggagctggggctggaactgccgggcggtaacaagccggaaccgcgtgactacgcg
gagctgctggagtcggttgccgatcgtcctgatgcagaaatgctgcaaaccatgctgctg
cgctcgatgaaacaggcgatttacgatccagaaaaccgtggtcactttggcctggcattg
cagtcctatgcgcactttacttcgccgattcgtcgttatccagacctgacgctgcaccgc
gccattaaatatctgctggcgaaagagcaggggcatcagggcaacaccactgaaaccggc
ggctaccattattcgatggaagagatgctgcaactgggtcagcactgttcgatggcggaa
cgtcgtgccgacgaagcaacgcgcgatgtggctgactggctgaagtgtgacttcatgctc
gaccaggtaggtaacgtctttaaaggcgtaatttccagcgtcactggctttggcttcttc
gtccgtctggacgacttgttcattgatggtctggtccatgtctcttcgctggacaatgac
tactatcgctttgaccaggtagggcaacgcctgatgggggaatccagcggccagacttat
cgcctgggcgatcgcgtggaagttcgcgtcgaagcggttaatatggacgagcgcaaaatc
gactttagcctgatctccagcgaacgcgcaccgcgcaacgtcggtaaaacggcgcgcgag
aaagcgaaaaaaggcgatgcaggtaaaaaaggcggcaagcgtcgtcaggtcggtaaaaag
gtaaactttgagccagacagcgccttccgcggtgagaaaaaaacgaagccgaaagcggcg
aagaaagacgcgagaaaagcgaaaaagccatcggcgaaaacgcagaaaatagctgcagcg
accaaagcgaagcgtgcggcgaagaaaaaagtggcagagtga

DBGET integrated database retrieval system