KEGG   Escherichia coli K-12 MG1655: b4183Help
Entry
b4183             CDS       T00007                                 

Gene name
yjfK
Definition
(RefSeq) DUF2491 family protein
Organism
eco  Escherichia coli K-12 MG1655
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF2491
Motif
Other DBs
NCBI-GeneID: 948702
NCBI-ProteinID: NP_418604
Pasteur: yjfK
RegulonDB: ECK120004344
ECOCYC: G7848
ASAP: ABE-0013692
UniProt: P39293
Position
4411302..4411961
Genome map
AA seq 219 aa AA seqDB search
MSGFFQRLFGKDNKPAIARGPLGLHLNSGFTLDTLAFRLLEDELLIALPGEEFTVAAVSH
IDLGGGSQIFRYYTSGDEFLQINTTGGEDIDDIDDIKLFVYEESYGISKESHWREAINAK
AMGAMTLNWQEKRWQRFFNSEEPGNIEPVYMLEKVENQNHAKWEVHNFTMGYQRQVTEDT
YEYLLLNGEESFNDLGEPEWLFSRALGVDIPLTSLHIIG
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
atgtctggttttttccagcgtctgtttggcaaggataataagccagctatcgctcgtggt
ccgctgggacttcatctcaatagtggctttacgctcgacacgttagcgtttcgtttgctg
gaagatgaattgctgattgcgctgccgggtgaggaatttacggtagccgccgtcagccac
atcgatctgggcggcggtagtcagattttccgctactacacttcaggcgatgagtttctg
caaatcaataccaccggcggcgaagatattgatgacattgatgatatcaagctctttgtc
tatgaagagagctacggtatcagtaaagagagtcactggcgcgaggcgatcaacgccaaa
gcgatgggagcaatgaccttaaactggcaggaaaaacgctggcagcgattttttaacagc
gaagaaccgggaaatatcgaacccgtctacatgctggaaaaagtagaaaatcaaaaccat
gccaaatgggaggtccataattttaccatgggctaccaacggcaagtaaccgaagatact
tacgaatatttgctgctaaatggtgaggaatcttttaacgatctcggcgagccagagtgg
ttattttcgcgcgcgttgggtgtcgatatcccgctgacatcacttcatattattggttaa

DBGET integrated database retrieval system