KEGG   Escherichia coli K-12 MG1655: b4184Help
Entry
b4184             CDS       T00007                                 

Gene name
yjfL
Definition
(RefSeq) UPF0719 family inner membrane protein
  KO
K08989  
putative membrane protein
Organism
eco  Escherichia coli K-12 MG1655
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Pasteur: 
RegulonDB: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Position
4411979..4412377
Genome map
AA seq 132 aa AA seqDB search
MHILDSLLAFSAYFFIGVAMVIIFLFIYSKITPHNEWQLIKNNNTAASLAFSGTLLGYVI
PLSSAAINAVSIPDYFAWGGIALVIQLLVFAGVRLYMPALSEKIINHNTAAGMFMGTAAL
AGGIFNAACMTW
NT seq 399 nt NT seq  +upstreamnt  +downstreamnt
atgcatatactggattcacttcttgcctttagcgcctatttttttattggcgtggctatg
gtgattatttttctgtttatctattctaaaattacaccgcacaacgaatggcagttaatc
aaaaacaataataccgcggcgtcactggcgttcagcggtacattgttgggttacgttatc
cccttatccagtgcggcaatcaatgcggtgagtattccagactatttcgcctggggcggg
attgcactggtgattcagttactcgtttttgctggtgtcagactttatatgcccgcatta
agcgaaaaaattattaatcacaataccgcagcaggaatgtttatgggaaccgccgcgctg
gctggcggtatttttaacgcagcttgtatgacatggtaa

DBGET integrated database retrieval system