KEGG   Escherichia coli K-12 MG1655: b4190Help
Entry
b4190             CDS       T00007                                 

Gene name
yjfP
Definition
(RefSeq) acyl CoA esterase
  KO
K06889  
uncharacterized protein
Organism
eco  Escherichia coli K-12 MG1655
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
RegulonDB: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Position
4416952..4417701
Genome map
AA seq 249 aa AA seqDB search
MIEIESRELADIPVLHAYPVGQKDTPLPCVIFYHGFTSSSLVYSYFAVALAQAGLRVIMP
DAPDHGSRFSGDAARRLNQFWQILLQSMQEFTTLRAAIAEENWLLDDRLAVGGASMGAMT
ALGITARHPTVRCTASMMGSGYFTSLARSLFPPLIPETAAQQNEFNNIVAPLAEWEATNH
LEQLSDRPLLLWHGLDDDVVPADESLRLQQALSETGRDKLLTCSWQPGVRHRITPEALDA
AVTFFRQHL
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgattgaaatagaatcacgcgagctggcagatattcccgttcttcatgcttatcctgtc
gggcaaaaagataccccgttaccgtgcgtaattttttatcacggctttacttcatccagt
ctggtgtatagctattttgccgttgcgctggcgcaggctggtttgcgggtgatcatgccg
gatgcgcccgatcacggtagccgttttagtggtgacgcagcgcggcggttaaatcaattc
tggcaaatcttgctacaaagtatgcaggaattcactactttacgtgcggcaatagccgaa
gaaaactggctgcttgatgaccgtctggcagtcggtggcgcgtcgatgggcgcgatgacg
gcactggggattaccgctcgccaccccacggtgagatgtaccgccagcatgatgggatcg
ggctattttacatcactcgcccgttcactgtttccaccgctgatacctgaaacggcagca
cagcagaatgaattcaataacattgtcgcgccactggcagagtgggaagcgacaaaccac
ctggaacaacttagtgacagacctctactgctgtggcatggcctcgacgatgacgttgtg
cctgccgacgaatcactacgtttgcagcaggccttaagcgagacgggacgggataaactg
ctaacctgttcatggcagccaggcgtgcgtcaccgcattacgcctgaggcgttagatgct
gccgtgacatttttccgccagcatctttaa

DBGET integrated database retrieval system