KEGG   Escherichia coli K-12 MG1655: b4193Help
Entry
b4193             CDS       T00007                                 

Gene name
ulaA
Definition
(RefSeq) L-ascorbate-specific enzyme IIC permease component of PTS
  KO
K03475  
PTS system, ascorbate-specific IIC component
Organism
eco  Escherichia coli K-12 MG1655
Pathway
Ascorbate and aldarate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Phosphotransferase system (PTS)
Module
PTS system, ascorbate-specific II component
Ascorbate degradation, ascorbate => D-xylulose-5P
Brite
KEGG Orthology (KO) [BR:eco00001]
 Metabolism
  Carbohydrate metabolism
   00053 Ascorbate and aldarate metabolism
    b4193 (ulaA)
 Environmental Information Processing
  Membrane transport
   02060 Phosphotransferase system (PTS)
    b4193 (ulaA)
Transporters [BR:eco02000]
 Phosphotransferase System (PTS)
  Enzyme II [TC:4.A]
   Ascorbate-specific II component [MD:M00283]
    b4193 (ulaA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Structure
PDB: 

Jmol
Position
4419980..4421377
Genome map
AA seq 465 aa AA seqDB search
MEILYNIFTVFFNQVMTNAPLLLGIVTCLGYILLRKSVSVIIKGTIKTIIGFMLLQAGSG
ILTSTFKPVVAKMSEVYGINGAISDTYASMMATIDRMGDAYSWVGYAVLLALALNICYVL
LRRITGIRTIMLTGHIMFQQAGLIAVTLFIFGYSMWTTIICTAILVSLYWGITSNMMYKP
TQEVTDGCGFSIGHQQQFASWIAYKVAPFLGKKEESVEDLKLPGWLNIFHDNIVSTAIVM
TIFFGAILLSFGIDTVQAMAGKVHWTVYILQTGFSFAVAIFIITQGVRMFVAELSEAFNG
ISQRLIPGAVLAIDCAAIYSFAPNAVVWGFMWGTIGQLIAVGILVACGSSILIIPGFIPM
FFSNATIGVFANHFGGWRAALKICLVMGMIEIFGCVWAVKLTGMSAWMGMADWSILAPPM
MQGFFSIGIAFMAVIIVIALAYMFFAGRALRAEEDAEKQLAEQSA
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atggagatcctctacaacatctttaccgtgttttttaaccaggtcatgaccaatgccccg
ttgttgctgggtattgtgacctgtctgggctacatcctactgcgcaaaagtgtcagcgtt
attattaaaggcacgattaaaaccataattggtttcatgttgttgcaggcagggtccggc
atcctcaccagcaccttcaaaccggtggtggcgaaaatgtccgaagtctacggcattaac
ggcgcaatttccgatacctacgcttcaatgatggcaaccatcgaccgcatgggcgatgcc
tatagctgggtgggttacgccgtattgttagcgctggcgctgaacatctgttacgtgctg
ttgcgtcgcattaccggcattcgcacaatcatgttgaccggccacatcatgttccagcag
gccgggttgattgccgttacgctgtttatcttcggctactccatgtggaccaccattatc
tgtaccgcgattctggtttcgctctactggggcatcacttccaacatgatgtacaagccg
actcaggaagtgacggatggctgtggtttctccatcggtcaccagcagcagtttgcatca
tggattgcctataaagtcgcgccgttcctcggcaaaaaagaggagagcgttgaagacctc
aaattgccgggctggctgaacattttccacgacaacatcgtctccacggcgattgtgatg
accatcttctttggtgccattctgctctccttcggtatcgacaccgtgcaggcgatggca
ggcaaagtgcactggacggtgtacatcctgcaaactggtttctcctttgcggtggcgatc
ttcatcatcacgcagggtgtgcgcatgtttgtggcggaactctctgaagcatttaacggc
atttcccagcgcctgatcccaggtgcggttctggcgattgactgtgcagctatctatagc
ttcgcgccgaacgccgtggtctggggctttatgtggggcaccatcggtcagctgattgcg
gttggcatcctggtcgcctgcggctcctcgatcctgattattcctggctttatcccgatg
ttcttctctaacgccaccatcggcgtgttcgctaaccacttcggcggctggcgtgcggcg
ctgaagatttgtctggtgatggggatgatcgaaatctttggttgcgtctgggcggtgaaa
ctcaccggtatgagtgcctggatgggcatggcggactggtcgattctggcaccgccgatg
atgcaaggcttcttctccatcggtatcgcctttatggccgtcatcattgtaattgcactg
gcttatatgttcttcgctggccgcgcgctgcgcgcagaagaagatgcagaaaaacaactg
gcagaacagtctgcttaa

DBGET integrated database retrieval system