KEGG   Escherichia coli K-12 MG1655: b4194Help
Entry
b4194             CDS       T00007                                 

Gene name
ulaB
Definition
(RefSeq) L-ascorbate-specific enzyme IIB component of PTS (EC:2.7.1.69)
  KO
K02822  
PTS system, ascorbate-specific IIB component [EC:2.7.1.194]
Organism
eco  Escherichia coli K-12 MG1655
Pathway
Ascorbate and aldarate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Phosphotransferase system (PTS)
Module
PTS system, ascorbate-specific II component
Ascorbate degradation, ascorbate => D-xylulose-5P
Brite
KEGG Orthology (KO) [BR:eco00001]
 Metabolism
  Carbohydrate metabolism
   00053 Ascorbate and aldarate metabolism
    b4194 (ulaB)
 Environmental Information Processing
  Membrane transport
   02060 Phosphotransferase system (PTS)
    b4194 (ulaB)
Enzymes [BR:eco01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.194  protein-Npi-phosphohistidine---L-ascorbate phosphotransferase
     b4194 (ulaB)
Transporters [BR:eco02000]
 Phosphotransferase System (PTS)
  Enzyme II [TC:4.A]
   Ascorbate-specific II component [MD:M00283]
    b4194 (ulaB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
RegulonDB: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Position
4421393..4421698
Genome map
AA seq 101 aa AA seqDB search
MTVRILAVCGNGQGSSMIMKMKVDQFLTQSNIDHTVNSCAVGEYKSELSGADIIIASTHI
AGEITVTGNKYVVGVRNMLSPADFGPKLLEVIKEHFPQDVK
NT seq 306 nt NT seq  +upstreamnt  +downstreamnt
atgaccgtacgtattctggctgtgtgtggcaacggacaaggcagttccatgatcatgaag
atgaaagtggaccagtttttaacccaatcaaacattgaccatacggtaaacagctgcgcg
gttggcgagtacaaaagcgagttgagtggcgcggatatcatcatcgcttctacgcacatt
gcgggcgaaatcaccgtgaccggcaacaaatacgtggttggcgtgcgcaacatgctctct
cctgccgactttggcccgaaactgctggaagtgatcaaagagcatttcccgcaggatgtg
aagtaa

DBGET integrated database retrieval system