KEGG   Escherichia coli K-12 MG1655: b4196Help
Entry
b4196             CDS       T00007                                 

Gene name
ulaD
Definition
(RefSeq) 3-keto-L-gulonate 6-phosphate decarboxylase (EC:4.1.2.-)
  KO
K03078  
3-dehydro-L-gulonate-6-phosphate decarboxylase [EC:4.1.1.85]
Organism
eco  Escherichia coli K-12 MG1655
Pathway
Ascorbate and aldarate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Module
Ascorbate degradation, ascorbate => D-xylulose-5P
Brite
KEGG Orthology (KO) [BR:eco00001]
 Metabolism
  Carbohydrate metabolism
   00053 Ascorbate and aldarate metabolism
    b4196 (ulaD)
Enzymes [BR:eco01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.85  3-dehydro-L-gulonate-6-phosphate decarboxylase
     b4196 (ulaD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
RegulonDB: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Structure
PDB: 

Jmol
Position
4422186..4422836
Genome map
AA seq 216 aa AA seqDB search
MSLPMLQVALDNQTMDSAYETTRLIAEEVDIIEVGTILCVGEGVRAVRDLKALYPHKIVL
ADAKIADAGKILSRMCFEANADWVTVICCADINTAKGALDVAKEFNGDVQIELTGYWTWE
QAQQWRDAGIGQVVYHRSRDAQAAGVAWGEADITAIKRLSDMGFKVTVTGGLALEDLPLF
KGIPIHVFIAGRSIRDAASPVEAARQFKRSIAELWG
NT seq 651 nt NT seq  +upstreamnt  +downstreamnt
atgtcattaccgatgttgcaagtcgcgctggacaaccagactatggatagcgcctacgaa
accactcgcctgattgccgaagaagtcgacattatcgaagtgggcaccattctgtgcgtg
ggcgaaggcgtgcgtgcggttcgtgacctgaaagcgctctacccgcacaaaatcgtactg
gcagacgccaaaattgccgatgcaggcaaaatcctttcgcgtatgtgcttcgaagccaac
gctgactgggtgacggtaatttgctgtgcggatatcaacaccgccaaaggcgcgctggac
gtggcaaaagagtttaacggcgacgtgcagatcgaactgaccggttactggacctgggaa
caggcgcaacagtggcgcgatgcaggcattgggcaggtggtttatcaccgcagccgtgac
gcgcaggccgcaggcgtggcgtggggcgaagcggacatcaccgcgatcaaacgtctttcc
gatatgggcttcaaagtcaccgtcaccggaggcctggcgctggaagatctgccgctgttc
aagggtattccgattcacgtctttatcgcgggccgtagtatccgtgatgccgcttctccg
gtggaagccgcacgtcagttcaaacgttccatcgctgaactgtggggctaa

DBGET integrated database retrieval system