KEGG   Escherichia coli K-12 MG1655: b4201Help
Entry
b4201             CDS       T00007                                 

Gene name
priB
Definition
(RefSeq) primosomal protein N
  KO
K02686  
primosomal replication protein N
Organism
eco  Escherichia coli K-12 MG1655
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:eco00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    b4201 (priB)
DNA repair and recombination proteins [BR:eco03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     b4201 (priB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Pasteur: 
RegulonDB: 
ECOCYC: 
ASAP: 
UniProt: 
Structure
PDB: 

Jmol
Position
4425520..4425834
Genome map
AA seq 104 aa AA seqDB search
MTNRLVLSGTVCRAPLRKVSPSGIPHCQFVLEHRSVQEEAGFHRQAWCQMPVIVSGHENQ
AITHSITVGSRITVQGFISCHKAKNGLSKMVLHAEQIELIDSGD
NT seq 315 nt NT seq  +upstreamnt  +downstreamnt
atgaccaaccgtctggtgttgtccggcaccgtgtgcagggctccccttcgaaaggtcagt
ccatcaggaattcctcactgccagttcgtgcttgagcatcgttctgtgcaggaggaagcc
ggctttcaccggcaggcgtggtgtcaaatgcccgttattgttagcggacacgaaaaccag
gccattactcacagtataacggtcggcagtcgcataaccgttcaggggttcatttcatgc
cacaaggcaaagaacggactgagcaaaatggttttgcatgccgagcagattgaattgata
gattctggagactag

DBGET integrated database retrieval system