KEGG   Escherichia coli K-12 MG1655: b4226Help
Entry
b4226             CDS       T00007                                 

Gene name
ppa
Definition
(RefSeq) inorganic pyrophosphatase
  KO
K01507  inorganic pyrophosphatase [EC:3.6.1.1]
Organism
eco  Escherichia coli K-12 MG1655
Pathway
eco00190  Oxidative phosphorylation
Brite
KEGG Orthology (KO) [BR:eco00001]
 Metabolism
  Energy metabolism
   00190 Oxidative phosphorylation
    b4226 (ppa)
Enzymes [BR:eco01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.1  inorganic diphosphatase
     b4226 (ppa)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyrophosphatase
Motif
Other DBs
NCBI-GeneID: 948748
NCBI-ProteinID: NP_418647
Pasteur: ppa
RegulonDB: ECK120000746
ECOCYC: EG10755
ASAP: ABE-0013824
UniProt: P0A7A9
Structure
PDB: 

Jmol
Position
complement(4449122..4449652)
Genome map
AA seq 176 aa AA seqDB search
MSLLNVPAGKDLPEDIYVVIEIPANADPIKYEIDKESGALFVDRFMSTAMFYPCNYGYIN
HTLSLDGDPVDVLVPTPYPLQPGSVIRCRPVGVLKMTDEAGEDAKLVAVPHSKLSKEYDH
IKDVNDLPELLKAQIAHFFEHYKDLEKGKWVKVEGWENAEAAKAEIVASFERAKNK
NT seq 531 nt NT seq  +upstreamnt  +downstreamnt
atgagcttactcaacgtccctgcgggtaaagatctgccggaagacatctacgttgttatt
gagatcccggctaacgcagatccgatcaaatacgaaatcgacaaagagagcggcgcactg
ttcgttgaccgcttcatgtccaccgcgatgttctatccatgcaactacggttacatcaac
cacaccctgtctctggacggtgacccggttgacgtactggtcccaactccgtacccgctg
cagccgggttctgtgatccgttgccgtccggttggcgttctgaaaatgaccgacgaagcc
ggtgaagatgcgaaactggttgcggttccgcacagcaagctgagcaaagaatacgatcac
attaaagacgttaacgatctgcctgaactgctgaaagcgcaaatcgctcacttcttcgag
cactacaaagacctcgaaaaaggcaagtgggtgaaagttgaaggttgggaaaacgcagaa
gccgctaaagctgaaatcgttgcctccttcgagcgcgcaaagaataaataa

DBGET integrated database retrieval system