KEGG   Escherichia coli K-12 MG1655: b4238Help
Entry
b4238             CDS       T00007                                 

Gene name
nrdD
Definition
(RefSeq) anaerobic ribonucleoside-triphosphate reductase
  KO
K00527  
ribonucleoside-triphosphate reductase [EC:1.17.4.2]
Organism
eco  Escherichia coli K-12 MG1655
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
Module
Pyrimidine deoxyribonuleotide biosynthesis, CDP/CTP => dCDP/dCTP,dTDP/dTTP
Brite
KEGG Orthology (KO) [BR:eco00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    b4238 (nrdD)
   00240 Pyrimidine metabolism
    b4238 (nrdD)
Enzymes [BR:eco01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.4  With a disulfide as acceptor
    1.17.4.2  ribonucleoside-triphosphate reductase
     b4238 (nrdD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Pasteur: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Position
complement(4460522..4462660)
Genome map
AA seq 712 aa AA seqDB search
MTPHVMKRDGCKVPFKSERIKEAILRAAKAAEVDDADYCATVAAVVSEQMQGRNQVDINE
IQTAVENQLMSGPYKQLARAYIEYRHDRDIEREKRGRLNQEIRGLVEQTNASLLNENANK
DSKVIPTQRDLLAGIVAKHYARQHLLPRDVVQAHERGDIHYHDLDYSPFFPMFNCMLIDL
KGMLTQGFKMGNAEIEPPKSISTATAVTAQIIAQVASHIYGGTTINRIDEVLAPFVTASY
NKHRKTAEEWNIPDAEGYANSRTIKECYDAFQSLEYEVNTLHTANGQTPFVTFGFGLGTS
WESRLIQESILRNRIAGLGKNRKTAVFPKLVFAIRDGLNHKKGDPNYDIKQLALECASKR
MYPDILNYDQVVKVTGSFKTPMGCRSFLGVWENENGEQIHDGRNNLGVISLNLPRIALEA
KGDEATFWKLLDERLVLARKALMTRIARLEGVKARVAPILYMEGACGVRLNADDDVSEIF
KNGRASISLGYIGIHETINALFGGEHVYDNEQLRAKGIAIVERLRQAVDQWKEETGYGFS
LYSTPSENLCDRFCRLDTAEFGVVPGVTDKGYYTNSFHLDVEKKVNPYDKIDFEAPYPPL
ANGGFICYGEYPNIQHNLKALEDVWDYSYQHVPYYGTNTPIDECYECGFTGEFECTSKGF
TCPKCGNHDASRVSVTRRVCGYLGSPDARPFNAGKQEEVKRRVKHLGNGQIG
NT seq 2139 nt NT seq  +upstreamnt  +downstreamnt
atgacaccgcatgtgatgaaacgagacggctgcaaagtgccgtttaaatcagagcgcatc
aaagaagcgattctgcgtgcagctaaagcagcggaagtcgatgatgccgattattgcgcc
actgttgccgcggttgtcagcgagcagatgcagggccgcaaccaggtggatatcaatgag
atccagaccgcagttgaaaatcagctgatgtcaggtccatacaaacaactggctcgtgct
tacatcgagtaccgtcacgatcgcgacattgaacgtgaaaaacgcggtcgcctgaaccag
gagatccgtggtctggtcgagcagaccaacgcctcgttactcaacgaaaacgccaacaaa
gacagcaaggtgattccaacccagcgcgacctgctggccgggatcgtggctaaacactat
gcacgtcagcacctgctgccgcgtgacgtggtgcaggcacatgagcgtggcgatattcac
tatcacgatctcgattactcaccgttcttcccgatgttcaactgcatgttgatcgacctg
aaaggcatgctgacccagggctttaaaatggggaacgccgagattgaaccgccgaagtcg
atctctacggcaaccgcggtaactgcgcagattattgctcaggttgccagccatatttat
ggcggcaccaccattaaccgtatcgatgaagtgctggcaccgtttgtcactgccagctac
aacaaacatcgcaagaccgcagaagagtggaacatcccggacgccgaaggctacgctaac
tctcgaaccatcaaagagtgctacgatgccttccagtcactggagtacgaagtaaacacc
ctgcacaccgccaacggtcagacgccgtttgtaacctttggttttggcctgggcaccagc
tgggaatcgcgcctgattcaggaatcgatcctgcgtaaccgtatcgcaggcctcggtaaa
aaccgtaaaactgcggtgttcccgaaactggtgtttgcgattcgcgatggcctgaaccat
aaaaaaggcgatccgaactacgacatcaaacagctggcgctggagtgcgcaagcaagcgc
atgtatccggatatcctgaactacgatcaggtagtgaaagtcaccggttcgtttaaaact
ccgatgggctgccgcagcttcctcggcgtgtgggaaaatgaaaacggcgagcagatccac
gatggtcgtaacaacctcggcgtgatcagcctgaacctgccgcgtattgctctggaagca
aaaggcgatgaagccaccttctggaagctgctggatgaacgtctggtgctggcacgtaag
gcgctgatgacccgtatcgctcgtctcgaaggcgtgaaagcgcgcgtggccccgatcctc
tatatggaaggtgcttgtggcgtgcgtctcaatgctgacgatgatgtttctgaaatcttc
aaaaacggtcgtgcgtctatttcgctgggttacatcggcatccacgaaaccattaacgcg
ctgttcggcggcgagcatgtttacgacaacgagcagcttcgcgcgaaaggtatcgccatt
gttgaacgtctgcgtcaggcagtggatcagtggaaagaagaaacgggttatggtttcagt
ctctacagcacgccgagtgaaaacctgtgcgatcgcttctgccgtctcgatactgctgag
tttggcgtggtgccgggcgtgaccgataaaggttactacaccaacagtttccacctcgat
gtggagaagaaggtgaacccgtacgacaagatcgactttgaagcgccttacccgccgctg
gcgaacggtggtttcatttgctacggcgagtatccaaacattcagcacaacctgaaggcg
ctggaagatgtctgggattacagctatcagcatgtaccgtattacggcaccaatacaccg
attgatgagtgctacgagtgtggctttaccggtgagttcgagtgcaccagcaaaggcttc
acttgcccgaaatgtggtaaccatgacgcctcccgtgtgtcggtaactcgccgcgtgtgc
ggatatttaggtagcccggatgcacgtccgtttaacgctggtaagcaggaagaagttaag
cgccgcgttaaacatttggggaatgggcagataggttaa

DBGET integrated database retrieval system