KEGG   Escherichia coli K-12 MG1655: b4241Help
Entry
b4241             CDS       T00007                                 

Gene name
treR
Definition
(RefSeq) trehalose 6-phosphate-inducible trehalose regulon transcriptional repressor
  KO
K03485  
LacI family transcriptional regulator, trehalose operon repressor
Organism
eco  Escherichia coli K-12 MG1655
Brite
Transcription factors [BR:eco03000]
 Prokaryotic Type
  Helix-turn-helix
   LacI family
    b4241 (treR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(4466299..4467246)
Genome map
AA seq 315 aa AA seqDB search
MQNRLTIKDIARLSGVGKSTVSRVLNNESGVSQLTRERVEAVMNQHGFSPSRSARAMRGQ
SDKVVAIIVTRLDSLSENLAVQTMLPAFYEQGYDPIMMESQFSPQLVAEHLGVLKRRNID
GVVLFGFTGITEEMLAHWQSSLVLLARDAKGFASVCYDDEGAIKILMQRLYDQGHRNISY
LGVPHSDVTTGKRRHEAYLAFCKAHKLHPVAALPGLAMKQGYENVAKVITPETTALLCAT
DTLALGASKYLQEQRIDTLQLASVGNTPLMKFLHPEIVTVDPGYAEAGRQAACQLIAQVT
GRSEPQQIIIPATLS
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaatcggctgaccatcaaagatatcgcgcgcttaagcggcgtggggaaatctaca
gtttcccgggtgctgaataacgaaagcggcgtgagccagctcacccgcgagcgtgttgaa
gcagtgatgaatcagcatggattttccccttcccgctctgcgcgcgctatgcgtgggcaa
agcgataaagtggtcgccatcattgttacccgtctggattcgttgtcagaaaatctcgcc
gttcaaaccatgctgccagcgttctatgaacaaggttacgacccaatcatgatggaaagt
cagttttccccgcaattagttgccgaacatttgggagtgctgaaacggcgtaatatcgac
ggcgtagtgctgttcggttttactggcataacagaagaaatgttagcccactggcagtca
tcgctggttctgctggcgcgtgacgcaaaaggctttgcttcggtctgttatgacgacgaa
ggggcaatcaaaatcctgatgcaacggctgtatgaccaggggcatcgtaatatcagttat
ctcggcgtgccgcacagtgacgtgacaaccggtaagcgacgtcacgaagcctacctggcg
ttctgcaaagcgcataaactgcatcccgttgccgccctgccagggcttgctatgaagcaa
ggctatgagaacgttgcaaaagtgattacgcctgaaactaccgccttactgtgcgcaacc
gacacgctggcacttggcgcaagtaaatacctgcaagagcaacgcatcgacaccttgcaa
ctggcgagcgtcggtaatacgccgttaatgaaattcctccatccggagatcgtaaccgta
gatcccggttacgccgaagctggacgccaggcggcttgccagttgatcgcgcaggtaacc
gggcgcagcgaaccgcaacaaatcatcatccccgccaccctgtcctga

DBGET integrated database retrieval system