KEGG   Escherichia coli K-12 MG1655: b4289Help
Entry
b4289             CDS       T00007                                 

Gene name
fecC
Definition
(RefSeq) iron-dicitrate transporter subunit
  KO
K02015  
iron complex transport system permease protein
Organism
eco  Escherichia coli K-12 MG1655
Pathway
ABC transporters
Module
Iron complex transport system
Brite
KEGG Orthology (KO) [BR:eco00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    b4289 (fecC)
Transporters [BR:eco02000]
 ABC Transporters, Prokaryotic Type
  Metallic cation, iron-siderophore and vitamin B12 transporters
   Iron complex transporter [MD:M00240]
    b4289 (fecC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
RegulonDB: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Position
complement(4512411..4513409)
Genome map
AA seq 332 aa AA seqDB search
MTAIKHPVLLWGLPVAALIIIFWLSLFCYSAIPVSGADATRALLPGHTPTLPEALVQNLR
LPRSLVAVLIGASLALAGTLLQTLTHNPMASPSLLGINSGAALAMALTSALSPTPIAGYS
LSFIAACGGGVSWLLVMTAGGGFRHTHDRNKLILAGIALSAFCMGLTRITLLLAEDHAYG
IFYWLAGGVSHARWQDVWQLLPVVVTAVPVVLLLANQLNLLNLSDSTAHTLGVNLTRLRL
VINMLVLLLVGACVSVAGPVAFIGLLVPHLARFWAGFDQRNVLPVSMLLGATLMLLADVL
ARALAFPGDLPAGAVLALIGSPCFVWLVRRRG
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcgataaaacacccggtgctgctgtgggggcttcccgttgcagcacttattatt
attttctggctgagtctgttttgctactcggccattcctgtttccggagcagatgcaacc
cgcgccctgctgcctggacacacgccaacgctaccagaagcgctggtgcaaaaccttcgt
ttgccacgaagcctggtcgccgttctgatcggcgcaagcctggcgctcgcgggcacgctg
ctgcaaaccctgacccacaacccaatggcctctccttcactgctcggcattaacagcggc
gcggcgctggctatggcgcttaccagcgcgctgagtccgacgccgattgcaggctattct
ctgtcattcatcgcggcatgcgggggcggcgtgagctggctgctggtcatgaccgcagga
ggcggatttcgtcatacccatgacagaaacaaactgatcctcgcgggtatcgcgctgtcg
gccttttgtatgggccttacccgcatcaccctgctgctggccgaagatcatgcttacggc
atcttttactggctggcaggcggagtgtcccacgcccgctggcaggatgtctggcagctc
ttgccggtggtggtcactgcagtccctgtcgtgttgctgctggcgaatcaactgaacctg
ctcaacctcagcgacagcaccgcccatacgctgggagtgaacctgacgaggctacgtttg
gtcatcaatatgttagtgctgcttctggttggtgcgtgcgtcagcgtagcaggtccggtg
gcgtttatcggtctgctggtgccacatctggcgcgcttctgggcaggcttcgatcagcgc
aacgtactgccagtgagcatgctgctgggggccacgctgatgctgctggcagatgtactc
gcacgcgcgctggccttccccggagatctgcccgcaggcgcagtgctggcgctgattggc
agcccttgctttgtctggcttgtgaggaggcgaggatga

DBGET integrated database retrieval system