KEGG   Escherichia coli K-12 MG1655: b4321Help
Entry
b4321             CDS       T00007                                 

Gene name
gntP
Definition
(RefSeq) fructuronate transporter
  KO
K16321  
high-affinity gluconate transporter
Organism
eco  Escherichia coli K-12 MG1655
Brite
Transporters [BR:eco02000]
 Other Transporters
  Electrochemical potential-driven transporters [TC:2]
   b4321 (gntP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
RegulonDB: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Position
complement(4549953..4551296)
Genome map
AA seq 447 aa AA seqDB search
MHVLNILWVVFGIGLMLVLNLKFKINSMVALLVAALSVGMLAGMDLMSLLHTMKAGFGNT
LGELAIIVVFGAVIGKLMVDSGAAHQIAHTLLARLGLRYVQLSVIIIGLIFGLAMFYEVA
FIMLAPLVIVIAAEAKIPFLKLAIPAVAAATTAHSLFPPQPGPVALVNAYGADMGMVYIY
GVLVTIPSVICAGLILPKFLGNLERPTPSFLKADQPVDMNNLPSFGVSILVPLIPAIIMI
STTIANIWLVKDTPAWEVVNFIGSSPIAMFIAMVVAFVLFGTARGHDMQWVMNAFESAVK
SIAMVILIIGAGGVLKQTIIDTGIGDTIGMLMSHGNISPYIMAWLITVLIRLATGQGVVS
AMTAAGIISAAILDPATGQLVGVNPALLVLATAAGSNTLTHINDASFWLFKGYFDLSVKD
TLKTWGLLELVNSVVGLIIVLIISMVA
NT seq 1344 nt NT seq  +upstreamnt  +downstreamnt
atgcatgtgcttaacattctctgggtggtattcggcattggtctgatgctggtactgaat
ttgaagttcaaaatcaattcaatggtggctttgttggtggcggcgctgtccgtcgggatg
ctggcgggcatggatttgatgtcgctgctgcacactatgaaagcgggcttcggcaacacg
ctgggggaactggctatcatcgtggtgttcggtgcggtcatcggtaaattgatggtcgac
tccggcgcggctcaccagatagcgcatacgctgctggcgcgtctcggtctgcgctatgta
cagctgtcggtgattatcatcggcctgatttttggtctggcgatgttctatgaagtggcc
tttatcatgttagcgccgctggttattgttattgccgccgaagctaaaattccgttcctg
aaactggcgatcccggcagtagcagctgccactaccgcacattcactgttcccaccgcag
ccgggtccggtggcgctggtgaatgcttatggcgcggatatggggatggtttatatctat
ggcgtactggtgacgatcccaagtgtaatctgcgcaggtctgatcctgccgaagttcctc
ggcaatcttgagcgcccaacgccatcattcctgaaagcagatcaaccggtagatatgaat
aatctgccctctttcggcgtttcgattctggtgccgctgatcccggcgatcattatgatc
tctaccaccatcgccaatatctggctggtaaaagatacccctgcctgggaagtggttaac
tttatcggttcctcgccgattgcaatgtttattgcgatggtggttgcattcgtactcttt
ggcaccgcacgtggtcatgacatgcagtgggtgatgaacgcttttgaaagcgcggtgaag
agtattgcaatggtgattctgatcatcggtgcgggtggcgtgctgaagcagaccatcatc
gacaccggcattggcgacaccatcggcatgttgatgtcccacggcaatatctcgccctac
atcatggcatggctgatcactgtgctaattcgtctggcgacgggtcagggtgtcgtttcg
gcgatgaccgccgccgggattatcagtgctgcaatcctagatccagcaactggtcagctg
gttggcgtgaatccggcgctgctggtactggcgacggctgcgggttccaacaccctcacc
cacattaacgatgcatctttctggttgttcaaaggttactttgacctgtcagtaaaagac
acgttgaaaacctggggtctgctggagctggtcaactccgtggttgggctgattattgtg
ctgattattagcatggtagcgtaa

DBGET integrated database retrieval system