KEGG   Escherichia coli K-12 MG1655: b4324Help
Entry
b4324             CDS       T00007                                 

Gene name
uxuR
Definition
(RefSeq) fructuronate-inducible hexuronate regulon transcriptional repressor; autorepressor
  KO
K13637  
GntR family transcriptional regulator, uxu operon transcriptional repressor
Organism
eco  Escherichia coli K-12 MG1655
Brite
Transcription factors [BR:eco03000]
 Prokaryotic Type
  Helix-turn-helix
   GntR family
    b4324 (uxuR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
RegulonDB: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Position
4554576..4555349
Genome map
AA seq 257 aa AA seqDB search
MKSATSAQRPYQEVGAMIRDLIIKTPYNPGERLPPEREIAEMLDVTRTVVREALIMLEIK
GLVEVRRGAGIYVLDNSGSQNTDSPDANVCNDAGPFELLQARQLLESNIAEFAALQATRE
DIVKMRQALQLEERELASSAPGSSESGDMQFHLAIAEATHNSMLVELFRQSWQWRENNPM
WIQLHSHLDDSLYRKEWLGDHKQILAALIKKDARAAKLAMWQHLENVKQRLLEFSNVDDI
YFDGYLFDSWPLDKVDA
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgaaatctgccacctctgcgcaaagaccttaccaggaagtcggggcgatgatccgcgat
ctgatcataaagacgccgtacaatcctggcgaacggctgccgccggagcgtgaaattgca
gaaatgcttgatgtcacgcggacggtggtacgtgaagcgctgatcatgctggagatcaaa
gggctggtggaagtacgccggggtgccggtatctatgttcttgataactcaggcagccag
aacacagacagtccggatgccaacgtctgcaacgatgccggtccttttgagctgttacag
gcgcggcagttattggagagcaacatcgccgagtttgccgctttgcaggctacccgcgaa
gatatcgtcaaaatgcgtcaggcattgcaactggaagagcgtgaactggcttccagtgcg
ccgggcagcagcgaaagcggtgacatgcagttccatctcgctattgccgaagcaacgcat
aacagcatgctggtggagctgttccgtcagtcctggcagtggcgggaaaacaatccaatg
tggatccagttgcacagccatctggatgacagcctgtatcgcaaagagtggttgggcgat
cacaaacagatcctcgccgcgttaatcaaaaaagatgcccgagcggcgaagctggcaatg
tggcagcatctggaaaacgttaagcaacgtctgctggaattctcgaacgttgacgatatt
tattttgatggctatctgtttgattcatggccgctggataaagtcgacgcctga

DBGET integrated database retrieval system