KEGG   Escherichia coli K-12 MG1655: b4324Help
Entry
b4324             CDS       T00007                                 

Gene name
uxuR
Definition
(RefSeq) fructuronate-inducible hexuronate regulon transcriptional repressor; autorepressor
  KO
K13637  GntR family transcriptional regulator, uxu operon transcriptional repressor
Organism
eco  Escherichia coli K-12 MG1655
Brite
Transcription factors [BR:eco03000]
 Prokaryotic Type
  Helix-turn-helix
   GntR family
    b4324 (uxuR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GntR FCD Rrf2 HTH_Crp_2 TrmB LexA_DNA_bind HTH_CodY MarR_2 HTH_11
Motif
Other DBs
NCBI-GeneID: 948849
NCBI-ProteinID: NP_418744
Pasteur: uxuR
RegulonDB: ECK120002447
ECOCYC: EG20249
ASAP: ABE-0014179
UniProt: P39161
Position
4554576..4555349
Genome map
AA seq 257 aa AA seqDB search
MKSATSAQRPYQEVGAMIRDLIIKTPYNPGERLPPEREIAEMLDVTRTVVREALIMLEIK
GLVEVRRGAGIYVLDNSGSQNTDSPDANVCNDAGPFELLQARQLLESNIAEFAALQATRE
DIVKMRQALQLEERELASSAPGSSESGDMQFHLAIAEATHNSMLVELFRQSWQWRENNPM
WIQLHSHLDDSLYRKEWLGDHKQILAALIKKDARAAKLAMWQHLENVKQRLLEFSNVDDI
YFDGYLFDSWPLDKVDA
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgaaatctgccacctctgcgcaaagaccttaccaggaagtcggggcgatgatccgcgat
ctgatcataaagacgccgtacaatcctggcgaacggctgccgccggagcgtgaaattgca
gaaatgcttgatgtcacgcggacggtggtacgtgaagcgctgatcatgctggagatcaaa
gggctggtggaagtacgccggggtgccggtatctatgttcttgataactcaggcagccag
aacacagacagtccggatgccaacgtctgcaacgatgccggtccttttgagctgttacag
gcgcggcagttattggagagcaacatcgccgagtttgccgctttgcaggctacccgcgaa
gatatcgtcaaaatgcgtcaggcattgcaactggaagagcgtgaactggcttccagtgcg
ccgggcagcagcgaaagcggtgacatgcagttccatctcgctattgccgaagcaacgcat
aacagcatgctggtggagctgttccgtcagtcctggcagtggcgggaaaacaatccaatg
tggatccagttgcacagccatctggatgacagcctgtatcgcaaagagtggttgggcgat
cacaaacagatcctcgccgcgttaatcaaaaaagatgcccgagcggcgaagctggcaatg
tggcagcatctggaaaacgttaagcaacgtctgctggaattctcgaacgttgacgatatt
tattttgatggctatctgtttgattcatggccgctggataaagtcgacgcctga

DBGET integrated database retrieval system