KEGG   Escherichia coli K-12 MG1655: b4373Help
Entry
b4373             CDS       T00007                                 

Gene name
rimI
Definition
(RefSeq) ribosomal-protein-S18-alanine N-acetyltransferase (EC:2.3.1.128)
  KO
K03789  
ribosomal-protein-alanine N-acetyltransferase [EC:2.3.1.128]
Organism
eco  Escherichia coli K-12 MG1655
Brite
Enzymes [BR:eco01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.128  ribosomal-protein-alanine N-acetyltransferase
     b4373 (rimI)
Ribosome biogenesis [BR:eco03009]
 Prokaryotic Type
  ribosomal protein modification factors
   b4373 (rimI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
RegulonDB: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Structure
PDB: 

Jmol
Position
4608185..4608631
Genome map
AA seq 148 aa AA seqDB search
MNTISSLETTDLPAAYHIEQRAHAFPWSEKTFASNQGERYLNFQLTQNGKMAAFAITQVV
LDEATLFNIAVDPDYQRQGLGRALLEHLIDELEKRGVATLWLEVRASNAAAIALYESLGF
NEATIRRNYYPTTDGREDAIIMALPISM
NT seq 447 nt NT seq  +upstreamnt  +downstreamnt
atgaacacgatttcttccctcgaaacgactgatttaccggcggcttaccacattgaacaa
cgcgcccacgcctttccgtggagtgaaaaaacgtttgccagcaaccagggcgagcgttat
ctcaactttcagttaacgcaaaacggcaaaatggcggcgtttgcgattacgcaagtggtg
ctggatgaagctacattgttcaatattgcggtcgatcctgactatcagcgtcagggattg
ggaagggcgctgctggaacatctgatcgacgaactggaaaaacgcggcgtggcgacacta
tggctggaagtccgtgcttcaaacgctgccgccattgccctgtacgaaagtttaggcttt
aacgaggcgacgattcgccgcaattactaccccaccacggacggtcgcgaagacgccatc
atcatggcgttgccaatcagtatgtaa

DBGET integrated database retrieval system