KEGG   Escherichia coli K-12 MG1655: b4391Help
Entry
b4391             CDS       T00007                                 

Gene name
yjjK
Definition
(RefSeq) putative transporter subunit of ABC superfamily: ATP-binding component
Organism
eco  Escherichia coli K-12 MG1655
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Pasteur: 
EcoGene: 
ASAP: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(4628855..4630522)
Genome map
AA seq 555 aa AA seqDB search
MAQFVYTMHRVGKVVPPKRHILKNISLSFFPGAKIGVLGLNGAGKSTLLRIMAGIDKDIE
GEARPQPDIKIGYLPQEPQLNPEHTVRESIEEAVSEVVNALKRLDEVYALYADPDADFDK
LAAEQGRLEEIIQAHDGHNLNVQLERAADALRLPDWDAKIANLSGGERRRVALCRLLLEK
PDMLLLDEPTNHLDAESVAWLERFLHDFEGTVVAITHDRYFLDNVAGWILELDRGEGIPW
EGNYSSWLEQKDQRLAQEASQEAARRKSIEKELEWVRQGTKGRQSKGKARLARFEELNST
EYQKRNETNELFIPPGPRLGDKVLEVSNLRKSYGDRLLIDDLSFSIPKGAIVGIIGPNGA
GKSTLFRMISGQEQPDSGTITLGETVKLASVDQFRDSMDNSKTVWEEVSGGLDIMKIGNT
EMPSRAYVGRFNFKGVDQGKRVGELSGGERGRLHLAKLLQVGGNMLLLDEPTNDLDIETL
RALENALLEFPGCAMVISHDRWFLDRIATHILDYQDEGKVEFFEGNFTEYEEYKKRTLGA
DALEPKRIKYKRIAK
NT seq 1668 nt NT seq  +upstreamnt  +downstreamnt
gtggctcaattcgtttataccatgcatcgtgtcggcaaagttgttccgccgaaacgtcat
attttgaaaaacatctctctgagtttcttccctggggcaaaaattggtgtcctgggtctg
aatggcgcgggtaagtccaccctgctgcgcattatggcgggcattgataaagacatcgaa
ggtgaagcgcgtccgcagccagacatcaagattggttatctgccgcaggaaccgcagctg
aacccggaacacaccgtgcgtgagtccattgaagaagcggtttcagaagtggttaacgcc
ctgaaacgcctggatgaagtgtatgcgctgtacgccgatccggatgccgattttgacaag
ctggccgctgaacaaggccgtctggaagagatcattcaggctcacgacggtcataatctg
aacgtacagctggagcgtgcggcggatgcgctacgtctgccggactgggacgcgaaaatc
gctaacctctccggtggtgaacgtcgtcgcgtagcgttgtgccgcctgctgctggaaaaa
ccagacatgctgctgctcgacgaaccgaccaaccacctggatgccgaatccgtggcctgg
ctggaacgcttcctgcacgacttcgaaggcaccgttgtggcgattacccacgaccgttac
ttcctcgataacgttgcaggctggatcctcgaacttgaccgcggtgaaggtattccgtgg
gaaggtaactactcctcctggctggagcagaaagatcagcgcctggcgcaggaagcttca
caagaagcggcgcgtcgtaagtcgattgagaaagagctggaatgggtacgtcaaggtact
aaaggccgtcagtcgaaaggtaaagcacgtctggcgcgctttgaagaactgaacagcacc
gaatatcagaaacgtaacgaaaccaacgaactgtttattccacctggaccgcgtctgggc
gataaagtgctggaagtcagcaacctgcgtaaatcctatggcgatcgtctgctgattgat
gacctgagcttctcgatcccgaaaggagcgatcgtcgggatcatcggtccgaacggtgcg
ggtaaatcgaccctgttccgtatgatctctggtcaggaacagccggacagcggcaccatc
actttgggtgaaacggtgaaactggcgtcggttgatcagttccgtgactcaatggataac
agcaaaaccgtttgggaagaagtttccggcgggctggatatcatgaagatcggcaacacc
gagatgccaagccgcgcctacgttggccgctttaactttaaaggggttgatcagggtaaa
cgcgttggtgaactctccggtggtgagcgcggtcgtctgcatctggcgaagctgctgcag
gttggcggcaacatgctgctgctcgacgaaccaaccaacgacctggatatcgaaaccctg
cgcgcgctggaaaacgccctgctggagttcccgggctgtgcgatggttatctcgcacgac
cgttggttcctcgaccgtatcgccacgcacattctggattaccaggatgaaggtaaagtt
gagttcttcgaaggtaactttaccgagtacgaagagtacaagaaacgcacgctgggcgca
gacgcgctggagccgaagcgtatcaagtacaagcgtattgcgaagtaa

DBGET integrated database retrieval system