KEGG   Escherichia coli K-12 MG1655: b4393Help
Entry
b4393             CDS       T00007                                 

Gene name
trpR
Definition
(RefSeq) transcriptional repressor, tryptophan-binding
  KO
K03720  
TrpR family transcriptional regulator, trp operon repressor
Organism
eco  Escherichia coli K-12 MG1655
Brite
Transcription factors [BR:eco03000]
 Prokaryotic Type
  Helix-turn-helix
   Other families
    b4393 (trpR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Structure
PDB: 

Jmol
Position
4632760..4633086
Genome map
AA seq 108 aa AA seqDB search
MAQQSPYSAAMAEQRHQEWLRFVDLLKNAYQNDLHLPLLNLMLTPDEREALGTRVRIVEE
LLRGEMSQRELKNELGAGIATITRGSNSLKAAPVELRQWLEEVLLKSD
NT seq 327 nt NT seq  +upstreamnt  +downstreamnt
atggcccaacaatcaccctattcagcagcgatggcagaacagcgtcaccaggagtggtta
cgttttgtcgacctgcttaagaatgcctaccaaaacgatctccatttaccgttgttaaac
ctgatgctgacgccagatgagcgcgaagcgttggggactcgcgtgcgtattgtcgaagag
ctgttgcgcggcgaaatgagccagcgtgagttaaaaaatgaactcggcgcaggcatcgcg
acgattacgcgtggatctaacagcctgaaagccgcgcccgtcgagctgcgccagtggctg
gaagaggtgttgctgaaaagcgattga

DBGET integrated database retrieval system