KEGG   Escherichia coli K-12 MG1655: b4395Help
Entry
b4395             CDS       T00007                                 

Gene name
ytjC
Definition
(RefSeq) phosphatase
  KO
K15634  
probable phosphoglycerate mutase [EC:5.4.2.12]
Organism
eco  Escherichia coli K-12 MG1655
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:eco00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    b4395 (ytjC)
   01230 Biosynthesis of amino acids
    b4395 (ytjC)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    b4395 (ytjC)
  Energy metabolism
   00680 Methane metabolism
    b4395 (ytjC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    b4395 (ytjC)
Enzymes [BR:eco01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.12  phosphoglycerate mutase (2,3-diphosphoglycerate-independent)
     b4395 (ytjC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Position
4633797..4634444
Genome map
AA seq 215 aa AA seqDB search
MLQVYLVRHGETQWNAERRIQGQSDSPLTAKGEQQAMQVATRAKELGITHIISSDLGRTR
RTAEIIAQACGCDIIFDSRLRELNMGVLEKRHIDSLTEEEENWRRQLVNGTVDGRIPEGE
SMQELSDRVNAALESCRDLPQGSRPLLVSHGIALGCLVSTILGLPAWAERRLRLRNCSIS
RVDYQESLWLASGWVVETAGDISHLDAPALDELQR
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
atgttacaggtatacctagtccgccacggtgaaacgcagtggaacgccgagcgacgtatt
cagggccagtctgacagcccgctgaccgccaaaggtgagcaacaggcgatgcaggtggca
acccgtgccaaagagcttggcattacgcatatcatcagtagcgatttaggacgcacccgg
cgtacggcggaaatcatcgcccaggcctgcggctgtgacatcatctttgattctcgcctg
cgtgaattaaacatgggtgtgctggaaaaaagacatatcgattctctgaccgaagaagaa
gagaactggcgtcggcagctggtcaatggcaccgttgacgggcgtattcctgaaggcgag
tcaatgcaggagctcagcgatcgcgtcaatgcggcactggaatcttgccgggacttaccg
cagggaagccgaccgctgctggtgagtcatggtattgcactgggatgcctggtgagtacg
attctcggattaccagcatgggcagagcgccgcttacgtctgcgtaactgttctatttcg
cgcgtggattatcaggaaagcctgtggctggcgtctggctgggtcgttgaaaccgcaggg
gacatctcgcatctggacgcccctgcattagatgagctgcagcgttaa

DBGET integrated database retrieval system