KEGG   Escherichia coli K-12 MG1655: b4395Help
Entry
b4395             CDS       T00007                                 

Gene name
ytjC
Definition
(RefSeq) phosphatase
  KO
K15634  probable phosphoglycerate mutase [EC:5.4.2.12]
Organism
eco  Escherichia coli K-12 MG1655
Pathway
eco00010  Glycolysis / Gluconeogenesis
eco00260  Glycine, serine and threonine metabolism
eco00680  Methane metabolism
eco01100  Metabolic pathways
eco01110  Biosynthesis of secondary metabolites
eco01120  Microbial metabolism in diverse environments
eco01130  Biosynthesis of antibiotics
eco01200  Carbon metabolism
eco01230  Biosynthesis of amino acids
Module
eco_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
eco_M00002  Glycolysis, core module involving three-carbon compounds
eco_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:eco00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    b4395 (ytjC)
  Energy metabolism
   00680 Methane metabolism
    b4395 (ytjC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    b4395 (ytjC)
Enzymes [BR:eco01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.12  phosphoglycerate mutase (2,3-diphosphoglycerate-independent)
     b4395 (ytjC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1 PTH2 Abhydrolase_9
Motif
Other DBs
NCBI-GeneID: 948918
NCBI-ProteinID: NP_418812
Pasteur: gpmB
RegulonDB: ECK120002060
ECOCYC: EG12164
ASAP: ABE-0014416
UniProt: P0A7A2
Position
4633797..4634444
Genome map
AA seq 215 aa AA seqDB search
MLQVYLVRHGETQWNAERRIQGQSDSPLTAKGEQQAMQVATRAKELGITHIISSDLGRTR
RTAEIIAQACGCDIIFDSRLRELNMGVLEKRHIDSLTEEEENWRRQLVNGTVDGRIPEGE
SMQELSDRVNAALESCRDLPQGSRPLLVSHGIALGCLVSTILGLPAWAERRLRLRNCSIS
RVDYQESLWLASGWVVETAGDISHLDAPALDELQR
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
atgttacaggtatacctagtccgccacggtgaaacgcagtggaacgccgagcgacgtatt
cagggccagtctgacagcccgctgaccgccaaaggtgagcaacaggcgatgcaggtggca
acccgtgccaaagagcttggcattacgcatatcatcagtagcgatttaggacgcacccgg
cgtacggcggaaatcatcgcccaggcctgcggctgtgacatcatctttgattctcgcctg
cgtgaattaaacatgggtgtgctggaaaaaagacatatcgattctctgaccgaagaagaa
gagaactggcgtcggcagctggtcaatggcaccgttgacgggcgtattcctgaaggcgag
tcaatgcaggagctcagcgatcgcgtcaatgcggcactggaatcttgccgggacttaccg
cagggaagccgaccgctgctggtgagtcatggtattgcactgggatgcctggtgagtacg
attctcggattaccagcatgggcagagcgccgcttacgtctgcgtaactgttctatttcg
cgcgtggattatcaggaaagcctgtggctggcgtctggctgggtcgttgaaaccgcaggg
gacatctcgcatctggacgcccctgcattagatgagctgcagcgttaa

DBGET integrated database retrieval system