KEGG   Escherichia coli K-12 MG1655: b4411Help
Entry
b4411             CDS       T00007                                 

Gene name
ecnB
Definition
(RefSeq) entericidin B membrane lipoprotein
  KO
K16348  
entericidin B
Organism
eco  Escherichia coli K-12 MG1655
Brite
Transporters [BR:eco02000]
 Other Transporters
  Others
   b4411 (ecnB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Pasteur: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Position
4376553..4376699
Genome map
AA seq 48 aa AA seqDB search
MVKKTIAAIFSVLVLSTVLTACNTTRGVGEDISDGGNAISGAATKAQQ
NT seq 147 nt NT seq  +upstreamnt  +downstreamnt
atggtgaagaagacaattgcagcgatcttttctgttctggtgctttcaacagtattaact
gcctgcaacaccacgcgtggcgttggtgaagacatttctgatggcggtaacgcgatttct
ggcgcagcaacgaaagcgcagcaataa

DBGET integrated database retrieval system