KEGG   Escherichia coli K-12 MG1655: b4460Help
Entry
b4460             CDS       T00007                                 

Gene name
araH
Definition
(RefSeq) fused L-arabinose transporter subunits of ABC superfamily: membrane components
  KO
K10538  
L-arabinose transport system permease protein
Organism
eco  Escherichia coli K-12 MG1655
Pathway
ABC transporters
Module
L-Arabinose transport system
Brite
KEGG Orthology (KO) [BR:eco00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    b4460 (araH)
Transporters [BR:eco02000]
 ABC Transporters, Prokaryotic Type
  Saccharide, polyol, and lipid transporters
   L-Arabinose transporter [MD:M00213] [OT]
    b4460 (araH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Position
complement(1982554..1983540)
Genome map
AA seq 328 aa AA seqDB search
MSSVSTSGSGAPKSSFSFGRIWDQYGMLVVFAVLFIACAIFVPNFATFINMKGLGLAISM
SGMVACGMLFCLASGDFDLSVASVIACAGVTTAVVINLTESLWIGVAAGLLLGVLCGLVN
GFVIAKLKINALITTLATMQIVRGLAYIISDGKAVGIEDESFFALGYANWFGLPAPIWLT
VACLIIFGLLLNKTTFGRNTLAIGGNEEAARLAGVPVVRTKIIIFVLSGLVSAIAGIILA
SRMTSGQPMTSIGYELIVISACVLGGVSLKGGIGKISYVVAGILILGTVENAMNLLNISP
FAQYVVRGLILLAAVIFDRYKQKAKRTV
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgtcttctgtttctacatcggggtctggcgcacctaagtcgtcattcagcttcgggcgt
atctgggatcagtacggcatgctggtggtgtttgcggtgctctttatcgcctgtgccatt
tttgtcccaaattttgccaccttcattaatatgaaagggttgggcctggcaatttccatg
tcggggatggtggcttgtggcatgttgttctgcctcgcttccggtgactttgacctttct
gtcgcctccgtaattgcctgtgcgggtgtcaccacggcggtggttattaacctgactgaa
agcctgtggattggcgtggcagcggggttgttgctgggcgttctctgtggcctggtcaat
ggctttgttatcgccaaactgaaaataaatgctctgatcacgacattggcaacgatgcag
attgttcgaggtctggcgtacatcatttcagacggtaaagcggtcggtatcgaagatgaa
agcttctttgcccttggttacgccaactggttcggtctgcctgcgccaatctggctcacc
gtcgcgtgtctgattatctttggtttgctgctgaataaaaccacctttggtcgtaacacc
ctggcgattggcgggaacgaagaggccgcgcgtctggcgggtgtaccggttgttcgcacc
aaaattattatctttgttctctcaggcctggtatcagcgatagccggaattattctggct
tcacgtatgaccagtgggcagccaatgacgtcgattggttatgagctgattgttatctcc
gcctgcgttttaggtggcgtttctctgaaaggtggcatcggaaaaatctcatatgtggtg
gcgggtatcttaattttaggcaccgtggaaaacgccatgaacctgcttaatatttctcct
ttcgcgcagtacgtggttcgcggcttaatcctgctggcagcggtgatcttcgaccgttac
aagcaaaaagcgaaacgcactgtctga

DBGET integrated database retrieval system