KEGG   Escherichia coli K-12 MG1655: b4468Help
Entry
b4468             CDS       T00007                                 

Gene name
glcE
Definition
(RefSeq) glycolate oxidase FAD binding subunit
  KO
K11472  glycolate oxidase FAD binding subunit
Organism
eco  Escherichia coli K-12 MG1655
Pathway
eco00630  Glyoxylate and dicarboxylate metabolism
eco01100  Metabolic pathways
eco01110  Biosynthesis of secondary metabolites
eco01120  Microbial metabolism in diverse environments
eco01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:eco00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    b4468 (glcE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_4
Motif
Other DBs
NCBI-GeneID: 2847718
NCBI-ProteinID: YP_026191
RegulonDB: ECK120004104
ECOCYC: G7544
ASAP: ABE-0174098
UniProt: P52073
Position
complement(3125470..3126522)
Genome map
AA seq 350 aa AA seqDB search
MLRECDYSQALLEQVNQAISDKTPLVIQGSNSKAFLGRPVTGQTLDVRCHRGIVNYDPTE
LVITARVGTPLVTIEAALESAGQMLPCEPPHYGEEATWGGMVACGLAGPRRPWSGSVRDF
VLGTRIITGAGKHLRFGGEVMKNVAGYDLSRLMVGSYGCLGVLTEISMKVLPRPRASLSL
RREISLQEAMSEIAEWQLQPLPISGLCYFDNALWIRLEGGEGSVKAARELLGGEEVAGQF
WQQLREQQLPFFSLPGTLWRISLPSDAPMMDLPGEQLIDWGGALRWLKSTAEDNQIHRIA
RNAGGHATRFSAGDGGFAPLSAPLFRYHQQLKQQLDPCGVFNPGRMYAEL
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgctacgcgagtgtgattacagccaggcgctgctggagcaggtgaatcaggcgattagc
gataaaacgccgctggtgattcagggcagcaatagcaaagcctttttaggtcgccctgtc
accgggcaaacgctggatgttcgttgtcatcgcggcattgttaattacgacccgaccgag
ctggtgataaccgcgcgtgtcggaacgccgctggtgacaattgaagcggcgctggaaagc
gcggggcaaatgctcccctgtgagccgccgcattatggtgaagaagccacctggggcggg
atggtcgcctgcgggctggcggggccgcgtcgcccgtggagcggttcggtccgcgatttt
gtcctcggcacgcgcatcattaccggcgctggaaaacatctgcgttttggtggcgaagtg
atgaaaaacgttgccggatacgatctctcacggttaatggtcggaagctacggttgtctt
ggcgtgctcactgaaatctcaatgaaagtgttaccgcgaccgcgcgcctccctgagcctg
cgtcgggaaatcagcctgcaagaagccatgagtgaaatcgccgagtggcaactccagcca
ttacccattagtggcttatgttacttcgacaatgcgttgtggatccgccttgagggcggc
gaaggatcggtaaaagcagcgcgtgaactgctgggtggcgaagaggttgccggtcagttc
tggcagcaattgcgtgaacaacaactgccgttcttctcgttaccaggtaccttatggcgc
atttcattacccagtgatgcgccgatgatggatttacccggcgagcaactgatcgactgg
ggcggggcgttacgctggctgaaatcgacagccgaggacaatcaaatccatcgcatcgcc
cgcaacgctggcggtcatgcgacccgctttagtgccggagatggtggctttgccccgcta
tcggctcctttattccgctatcaccagcagcttaaacagcagctcgacccttgcggcgtg
tttaaccccggtcgcatgtacgcggaactttga

DBGET integrated database retrieval system