KEGG   Escherichia coli K-12 MG1655: b4468Help
Entry
b4468             CDS       T00007                                 

Gene name
glcE
Definition
(RefSeq) glycolate oxidase FAD binding subunit
  KO
K11472  
glycolate oxidase FAD binding subunit
Organism
eco  Escherichia coli K-12 MG1655
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:eco00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    b4468 (glcE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Position
complement(3125470..3126522)
Genome map
AA seq 350 aa AA seqDB search
MLRECDYSQALLEQVNQAISDKTPLVIQGSNSKAFLGRPVTGQTLDVRCHRGIVNYDPTE
LVITARVGTPLVTIEAALESAGQMLPCEPPHYGEEATWGGMVACGLAGPRRPWSGSVRDF
VLGTRIITGAGKHLRFGGEVMKNVAGYDLSRLMVGSYGCLGVLTEISMKVLPRPRASLSL
RREISLQEAMSEIAEWQLQPLPISGLCYFDNALWIRLEGGEGSVKAARELLGGEEVAGQF
WQQLREQQLPFFSLPGTLWRISLPSDAPMMDLPGEQLIDWGGALRWLKSTAEDNQIHRIA
RNAGGHATRFSAGDGGFAPLSAPLFRYHQQLKQQLDPCGVFNPGRMYAEL
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgctacgcgagtgtgattacagccaggcgctgctggagcaggtgaatcaggcgattagc
gataaaacgccgctggtgattcagggcagcaatagcaaagcctttttaggtcgccctgtc
accgggcaaacgctggatgttcgttgtcatcgcggcattgttaattacgacccgaccgag
ctggtgataaccgcgcgtgtcggaacgccgctggtgacaattgaagcggcgctggaaagc
gcggggcaaatgctcccctgtgagccgccgcattatggtgaagaagccacctggggcggg
atggtcgcctgcgggctggcggggccgcgtcgcccgtggagcggttcggtccgcgatttt
gtcctcggcacgcgcatcattaccggcgctggaaaacatctgcgttttggtggcgaagtg
atgaaaaacgttgccggatacgatctctcacggttaatggtcggaagctacggttgtctt
ggcgtgctcactgaaatctcaatgaaagtgttaccgcgaccgcgcgcctccctgagcctg
cgtcgggaaatcagcctgcaagaagccatgagtgaaatcgccgagtggcaactccagcca
ttacccattagtggcttatgttacttcgacaatgcgttgtggatccgccttgagggcggc
gaaggatcggtaaaagcagcgcgtgaactgctgggtggcgaagaggttgccggtcagttc
tggcagcaattgcgtgaacaacaactgccgttcttctcgttaccaggtaccttatggcgc
atttcattacccagtgatgcgccgatgatggatttacccggcgagcaactgatcgactgg
ggcggggcgttacgctggctgaaatcgacagccgaggacaatcaaatccatcgcatcgcc
cgcaacgctggcggtcatgcgacccgctttagtgccggagatggtggctttgccccgcta
tcggctcctttattccgctatcaccagcagcttaaacagcagctcgacccttgcggcgtg
tttaaccccggtcgcatgtacgcggaactttga

DBGET integrated database retrieval system