KEGG   Escherichia coli K-12 MG1655: b4470Help
Entry
b4470             CDS       T00007                                 

Gene name
yhaM
Definition
(RefSeq) putative L-serine dehydratase alpha chain
Organism
eco  Escherichia coli K-12 MG1655
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
RegulonDB: 
ECOCYC: 
ASAP: 
UniProt: 
Position
complement(3255341..3256651)
Genome map
AA seq 436 aa AA seqDB search
MFDSTLNPLWQRYILAVQEEVKPALGCTEPISLALAAAVAAAELEGPVERVEAWVSPNLM
KNGLGVTVPGTGMVGLPIAAALGALGGNANAGLEVLKDATAQAIADAKALLAAGKVSVKI
QEPCDEILFSRAKVWNGEKWACVTIVGGHTNIVHIETHDGVVFTQQACVAEGEQESPLTV
LSRTTLAEILKFVNEVPFAAIRFILDSAKLNCALSQEGLSGKWGLHIGATLEKQCERGLL
AKDLSSSIVIRTSAASDARMGGATLPAMSNSGSGNQGITATMPVVVVAEHFGADDERLAR
ALMLSHLSAIYIHNQLPRLSALCAATTAAMGAAAGMAWLVDGRYETISMAISSMIGDVSG
MICDGASNSCAMKVSTSASAAWKAVLMALDDTAVTGNEGIVAHDVEQSIANLCALASHSM
QQTDRQIIEIMASKAR
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
atgtttgattcgactttaaatccgttatggcagcgttacatcctcgccgttcaggaggaa
gtaaaaccggcgctgggatgtactgaaccgatttcactggcgctggcggcggcggttgct
gcggcagaactggaaggtccggttgaacgtgtagaagcctgggtttcgccaaatctgatg
aagaacggtctgggcgtcaccgttcccggcacgggaatggtggggctgccgattgcggcg
gcgctgggggcgttaggtggaaatgccaacgccgggctggaagtgctgaaagacgcaaca
gcgcaggcaattgccgatgccaaagcactgctggcggcggggaaagtctccgttaagatc
caggaaccttgcgatgaaatcctcttctcacgcgccaaagtctggaacggtgagaagtgg
gcgtgtgtcaccatcgtcggcgggcataccaacattgtgcatatcgagacgcacgatggt
gtggtgtttacccagcaggcgtgtgtggcagagggcgagcaagagtctccgctgacggtg
ctttccagaacgacgctggctgagatcctgaagttcgtcaatgaagtcccgtttgcggcg
atccgctttattctcgattccgcgaagctaaattgtgcgttatcgcaggaaggtttgagc
ggtaagtgggggctgcatattggcgcgacgctggaaaaacagtgcgagcgcggtttgctg
gcgaaagatctctcttcatccattgtgattcgtaccagcgcggcatccgatgcgcgtatg
ggcggcgctacgcttccggctatgagtaactccggctcgggtaaccaggggattaccgca
acaatgcctgtggtggtggtagcagaacacttcggagcggatgatgaacggctggcgcgt
gcgctgatgctttcgcatttgagcgcaatttacatccataaccagttaccgcgtttgtct
gcgctgtgtgccgcaacgaccgcagcaatgggggccgccgccgggatggcatggctggtg
gatgggcgttatgaaaccatctcgatggcgatcagcagtatgatcggcgatgtcagcggc
atgatttgcgatggtgcgtcgaacagctgcgcgatgaaggtttcgaccagtgcttcggct
gcgtggaaagcggtgttaatggcgctggatgataccgccgtgaccggcaatgaagggatt
gtggcgcatgatgttgagcagtcgattgccaacctgtgtgcgttagcaagccattcgatg
cagcaaacggatcggcagattatcgagattatggcgagcaaggccagataa

DBGET integrated database retrieval system