KEGG   Escherichia coli K-12 MG1655: b4476Help
Entry
b4476             CDS       T00007                                 

Gene name
gntU
Definition
(RefSeq) gluconate transporter, low affinity GNT 1 system
  KO
K06156  
Gnt-I system low-affinity gluconate transporter
Organism
eco  Escherichia coli K-12 MG1655
Brite
Transporters [BR:eco02000]
 Other Transporters
  Electrochemical potential-driven transporters [TC:2]
   b4476 (gntU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
RegulonDB: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Position
complement(3575721..3577061)
Genome map
AA seq 446 aa AA seqDB search
MTTLTLVLTAVGSVLLLLFLVMKARMHAFLALMVVSMGAGLFSGMPLDKIAATMEKGMGG
TLGFLAVVVALGAMFGKILHETGAVDQIAVKMLKSFGHSRAHYAIGLAGLVCALPLFFEV
AIVLLISVAFSMARHTGTNLVKLVIPLFAGVAAAAAFLVPGPAPMLLASQMNADFGWMIL
IGLCAAIPGMIIAGPLWGNFISRYVELHIPDDISEPHLGEGKMPSFGFSLSLILLPLVLV
GLKTIAARFVPEGSTAYEWFEFIGHPFTAILVACLVAIYGLAMRQGMPKDKVMEICGHAL
QPAGIILLVIGAGGVFKQVLVDSGVGPALGEALTGMGLPIAITCFVLAAAVRIIQGSATV
ACLTAVGLVMPVIEQLNYSGAQMAALSICIAGGSIVVSHVNDAGFWLFGKFTGATEAETL
KTWTMMETILGTVGAIVGMIAFQLLS
NT seq 1341 nt NT seq  +upstreamnt  +downstreamnt
gtgactacattaacgcttgttttaacagcagtagggtctgttttactgctgctgttttta
gtcatgaaggcgcgtatgcacgctttcctggctttaatggtggtgtccatgggggctggc
cttttttctggtatgccgctcgataaaatcgcagcgacgatggaaaaagggatgggaggc
accctcggcttcctggcggtggttgtcgccctgggagctatgtttggcaagatcttacat
gaaaccggcgcagtcgatcagattgccgtcaaaatgctcaaatccttcggtcacagccgc
gcgcattatgccatcggccttgcggggctggtctgtgcgctaccgctgttctttgaagtg
gcgatagttctgctgattagcgttgctttctcaatggcgcgccacaccggtacgaacctg
gtgaagctggtaatcccattatttgcaggcgtggcggcagcggcggcatttctggtgcct
ggaccagcgccgatgctgctggcatcgcagatgaatgccgactttggctggatgatcctg
attggcctgtgtgcggcaattccgggaatgattattgccgggccgctgtggggtaacttc
atcagccgttacgttgagctgcatattcctgacgacatcagcgaaccgcatctcggcgaa
ggcaaaatgccatctttcggattcagcctgtcgctgatcctgctgccgctggtgctggta
gggctgaaaaccattgccgcgcgttttgtgccggaaggatcaactgcttacgaatggttt
gagtttatcggtcatccgtttaccgcgattctggttgcttgtctggtggcgatttacggt
ctggcaatgcgtcagggcatgccaaaagacaaagtgatggagatttgcggtcacgcgctg
caaccggcggggatcattctgctggtgattggtgcgggcggcgtgttcaaacaggtgctg
gttgactctggcgtaggtccggcactgggcgaagcgttaaccggcatgggcctgccgatt
gctatcacctgcttcgtgctggcagctgcagtgcgcatcattcagggttctgccaccgta
gcctgtttaacggcggtaggactggtgatgccggttattgaacaactgaactactccggt
gcgcaaatggcggcgctgtcgatttgtatcgctggtggttcgattgttgtcagccacgtt
aacgacgccggtttctggttgttcggtaaatttaccggcgcgaccgaagccgaaacgctg
aaaacctggaccatgatggaaaccatcctcggcactgtcggtgccatcgttgggatgatt
gcgttccagctgttgagttaa

DBGET integrated database retrieval system