KEGG   Escherichia coli K-12 MG1655: b4477Help
Entry
b4477             CDS       T00007                                 

Gene name
dgoA
Definition
(RefSeq) 2-oxo-3-deoxygalactonate 6-phosphate aldolase (EC:4.1.2.21)
  KO
K01631  
2-dehydro-3-deoxyphosphogalactonate aldolase [EC:4.1.2.21]
Organism
eco  Escherichia coli K-12 MG1655
Pathway
Galactose metabolism
Metabolic pathways
Module
D-galactonate degradation, De Ley-Doudoroff pathway, D-galactonate => glycerate-3P
Brite
KEGG Orthology (KO) [BR:eco00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    b4477 (dgoA)
Enzymes [BR:eco01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.21  2-dehydro-3-deoxy-6-phosphogalactonate aldolase
     b4477 (dgoA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(3872995..3873612)
Genome map
AA seq 205 aa AA seqDB search
MQWQTKLPLIAILRGITPDEALAHVGAVIDAGFDAVEIPLNSPQWEQSIPAIVDAYGDKA
LIGAGTVLKPEQVDALARMGCQLIVTPNIHSEVIRRAVGYGMTVCPGCATATEAFTALEA
GAQALKIFPSSAFGPQYIKALKAVLPSDIAVFAVGGVTPENLAQWIDAGCAGAGLGSDLY
RAGQSVERTAQQAAAFVKAYREAVQ
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atgcagtggcaaactaaactcccgctgatcgccattttgcgcggtattacgcccgacgag
gcgctggcgcatgttggcgcggtgattgacgccgggttcgacgcggttgaaatcccgctg
aattccccacaatgggagcaaagcattcccgccatcgttgatgcgtacggcgacaaggcg
ttgattggcgcaggtacggtactgaaacctgaacaggtcgatgcgctcgccaggatgggc
tgtcagctcatcgttacgcccaatatccatagtgaagtgatccgccgtgcggtgggctac
ggcatgaccgtctgccccggctgcgcgacggcgaccgaagcctttaccgcgctcgaagcg
ggcgcgcaggcgctgaaaatatttccgtcatcggcttttggtccgcaatacatcaaagcg
ttaaaagcggtattgccatcggacatcgcagtctttgccgttggcggcgtgacgccagaa
aacctggcgcagtggatagacgcaggttgtgcaggggcgggcttaggcagcgatctctat
cgcgccgggcaatccgtagagcgcaccgcgcagcaggcagcagcatttgttaaggcgtat
cgagaggcagtgcaatga

DBGET integrated database retrieval system