KEGG   Escherichia coli K-12 MG1655: b4515Help
Entry
b4515             CDS       T00007                                 

Gene name
cydX
Definition
(RefSeq) cytochrome d (bd-I) ubiquinol oxidase subunit X
Organism
eco  Escherichia coli K-12 MG1655
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Position
774196..774309
Genome map
AA seq 37 aa AA seqDB search
MWYFAWILGTLLACSFGVITALALEHVESGKAGQEDI
NT seq 114 nt NT seq  +upstreamnt  +downstreamnt
atgtggtatttcgcatggattctgggaacgcttcttgcctgttcgtttggggtaatcacc
gcgctggcgcttgaacacgtcgaatcaggcaaagccggtcaagaagacatctga

DBGET integrated database retrieval system