KEGG   Escherichia coli K-12 MG1655: b4544Help
Entry
b4544             CDS       T00007                                 

Gene name
arnE
Definition
(RefSeq) undecaprenyl phosphate-alpha-L-ara4N exporter; flippase ArnEF subunit
  KO
K12962  
undecaprenyl phosphate-alpha-L-ara4N flippase subunit ArnE
Organism
eco  Escherichia coli K-12 MG1655
Pathway
Cationic antimicrobial peptide (CAMP) resistance
Module
Cationic antimicrobial peptide (CAMP) resistance, arnBCADTEF operon
Brite
KEGG Orthology (KO) [BR:eco00001]
 Human Diseases
  Antimicrobial resistance
   01503 Cationic antimicrobial peptide (CAMP) resistance
    b4544 (arnE)
Lipopolysaccharide biosynthesis proteins [BR:eco01005]
 Unusual sugar
  b4544 (arnE)
Transporters [BR:eco02000]
 Other Transporters
  Electrochemical potential-driven transporters [TC:2]
   b4544 (arnE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Position
2372557..2372892
Genome map
AA seq 111 aa AA seqDB search
MIWLTLVFASLLSVAGQLCQKQATCFVAINKRRKHIVLWLGLALACLGLAMVLWLLVLQN
VPVGIAYPMLSLNFVWVTLAAVKLWHEPVSPRHWCGVAFIIGGIVILGSTV
NT seq 336 nt NT seq  +upstreamnt  +downstreamnt
atgatctggctaacattagtctttgccagcttgcttagcgttgccgggcagttgtgtcag
aaacaggcaacctgctttgtggcgataaacaaacggcgcaaacatatcgtgctgtggctg
ggactggcgctggcttgtcttggtcttgccatggtgctctggctgctggtcttgcagaac
gtaccggtaggcattgcttacccgatgttaagtctgaattttgtctgggtgacgctggct
gcagtaaaactgtggcacgaaccggtatcgccgcgtcactggtgtggggtggcgttcatt
attggcggcattgtgatcctcgggagtacggtgtaa

DBGET integrated database retrieval system