KEGG   Escherichia coli K-12 MG1655: b4565Help
Entry
b4565             CDS       T00007                                 

Gene name
sgcB
Definition
(RefSeq) putative enzyme IIB component of PTS
  KO
K02774  
PTS system, galactitol-specific IIB component [EC:2.7.1.200]
Organism
eco  Escherichia coli K-12 MG1655
Pathway
Galactose metabolism
Metabolic pathways
Phosphotransferase system (PTS)
Module
PTS system, galactitol-specific II component
Brite
KEGG Orthology (KO) [BR:eco00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    b4565 (sgcB)
 Environmental Information Processing
  Membrane transport
   02060 Phosphotransferase system (PTS)
    b4565 (sgcB)
Enzymes [BR:eco01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.200  protein-Npi-phosphohistidine---galactitol phosphotransferase
     b4565 (sgcB)
Transporters [BR:eco02000]
 Phosphotransferase System (PTS)
  Enzyme II [TC:4.A]
   Galactitol-specific II component [MD:M00279]
    b4565 (sgcB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Position
complement(4530255..4530533)
Genome map
AA seq 92 aa AA seqDB search
MKKILVACGTGMSTSTMIAHKLQEFLTEQGISATTAQCCLNEIPLNCNGMDLIVTSMRTN
SDYGIPTLNGAALLTGINDDALKQQIKALLTQ
NT seq 279 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagatccttgtggcatgcggtaccggcatgtcgacttcaaccatgattgcacac
aagctgcaagagttcctgactgaacagggcatttcagccactaccgcccaatgctgtctg
aatgagatccctcttaactgtaacggtatggaccttattgtaacctccatgcgaaccaac
agtgattacggcatccctacgcttaatggcgccgccctgctcacagggatcaacgacgac
gcgttaaaacaacaaatcaaggctctgttaactcaataa

DBGET integrated database retrieval system