KEGG   Escherichia coli K-12 MG1655: b4672Help
Entry
b4672             CDS       T00007                                 

Gene name
ymiB
Definition
(RefSeq) uncharacterized protein
Organism
eco  Escherichia coli K-12 MG1655
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
EcoGene: 
UniProt: 
Position
1346796..1346900
Genome map
AA seq 34 aa AA seqDB search
MTYMKLTAAKRIVFFIYLFVIQFWKNASFQTKVS
NT seq 105 nt NT seq  +upstreamnt  +downstreamnt
atgacttacatgaaattaacggcggctaaacgcattgttttttttatatatttatttgta
atccagttttggaaaaacgccagttttcaaacgaaagtcagttaa

DBGET integrated database retrieval system