KEGG   Escherichia coli APEC O78: APECO78_07355Help
Entry
APECO78_07355     CDS       T02445                                 

Definition
acyl-CoA thioesterase
Orthology
K01051  
pectinesterase [EC:3.1.1.11]
Organism
ecoa  Escherichia coli APEC O78
Pathway
Pentose and glucuronate interconversions
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ecoa00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    APECO78_07355
   00500 Starch and sucrose metabolism
    APECO78_07355
Enzymes [BR:ecoa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.11  pectinesterase
     APECO78_07355
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(1523982..1525265)
Genome map
AA seq 427 aa AA seqDB search
MNTFSVSRLALALAFGVTLTACSSTPPDQRPSDQTAPGTSSRPILSAKEAQNFDAQHYFA
SLTPGAAAWNPSPITLPAQPDFVVGPAGTQGVTHTTIQAAVDAAIIKRTNKRQYIAVMPG
EYQGTVYVPAAPGGITLYGTGEKPIDVKIGLSLDGGMSPADWRHDVNPRGKYMPGKPAWY
MYDSCQSKRSDSIGVLCSAVFWSQNNGLQLQNLTIENTLGDSVDAGNHPAVALRTDGDQV
QINNVNILGRQNTFFVTNSGVQNRLETNRQPRTLVTNSYIEGDVDIVSGRGAVVFDNTEF
RVVNSRTQQEAYVFAPATLSNIYYGFLAVNSRFNAFGDGVAQLGRSLDVDANTNGQVVIR
DSAINEGFNTAKPWADAVISNRPFAGNTGSVDDNDEIQRNLNDTNYNRMWEYNNRGVGSK
VVAEAKK
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
gtgaacacattttcagtttcccgtctggcgctggcattggcttttggcgtgacgctgacc
gcctgtagctcaaccccgcccgatcaacgtccttctgatcaaaccgcgcctggtacctct
tctcgcccgattctgtcggcaaaagaagcgcagaatttcgatgctcaacactattttgca
tccctgacaccaggtgcagcagcgtggaatccttccccgattaccctgcctgcgcaacct
gactttgttgtcggcccggcgggcactcaaggtgtaacgcataccacgattcaggcggcg
gtagatgcggcaattatcaagcgtaccaacaagcgccagtatattgccgtgatgcctggt
gagtatcagggaacggtatatgtccctgccgctccgggtggaattactctgtacggtaca
ggtgaaaaaccgattgatgtgaagattgggctttcccttgatggtggcatgagccctgcc
gactggcgtcacgacgtcaacccgcgcggcaaatatatgccaggtaaaccagcgtggtat
atgtacgatagctgccagagcaaacgcagcgacagtatcggtgttctctgctctgcggtc
ttctggtcacaaaacaatggcctgcaactgcaaaatctgaccatcgaaaacacgctgggc
gatagcgtagatgcaggtaaccatccggcggtggcactgcgtactgatggtgaccaggta
cagattaacaacgttaacattctcggtcgtcagaacaccttctttgtcaccaacagcggt
gtgcagaaccgtctggaaacgaatcgtcagccgcgtacgctggtgaccaacagctacatt
gaaggggatgtggatatcgtttctggtcgcggcgcagtggtgttcgataacaccgaattc
cgcgtggtgaactcacgtactcagcaagaagcgtatgtgtttgcaccggctacgctgtcc
aacatttactacggtttcctcgccgtaaacagccgtttcaatgctttcggtgatggtgtg
gcgcaactgggccgctcgctggatgttgatgccaataccaacggtcaggtggtgatccgt
gatagcgccatcaacgaaggttttaacacggctaaaccgtgggccgatgcggtgatctct
aatcgtccgtttgcgggtaataccggcagcgtagatgataacgacgaaatacagcgcaat
ctgaatgacactaactacaaccgcatgtgggaatacaataaccgcggcgtgggtagtaaa
gtggttgcagaggcgaagaagtaa

DBGET integrated database retrieval system