KEGG   Escherichia coli PMV-1: ECOPMV1_00155Help
Entry
ECOPMV1_00155     CDS       T02847                                 

Gene name
mrcB
Definition
Murein polymerase
Orthology
K05365  
penicillin-binding protein 1B [EC:2.4.1.129 3.4.-.-]
Organism
ecoi  Escherichia coli PMV-1
Pathway
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:ecoi00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    ECOPMV1_00155 (mrcB)
Enzymes [BR:ecoi01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.129  peptidoglycan glycosyltransferase
     ECOPMV1_00155 (mrcB)
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.-  Acting on peptide bonds (peptidases)
    3.4.-.-  
     ECOPMV1_00155 (mrcB)
Glycosyltransferases [BR:ecoi01003]
 Polysaccharide
  Bacterial polysaccharide
   ECOPMV1_00155 (mrcB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
170798..173332
Genome map
AA seq 844 aa AA seqDB search
MAGNDREPIGRKGKPTRPVKQKVSRRRYEDDDDYDDYDDYEDEEPMPRKGKGKGKGRKPR
GKRGWLWLLLKLAIVFAVLIAIYGVYLDQKIRSRIDGKVWQLPAAVYGRMVNLEPDMTIS
KNEMVKLLEATQYRQVSKMTRPGEFTVQANSIEMIRRPFDFPDSKEGQVRARLTFDGDHL
ATIVNMENNRQFGFFRLDPRLITMISSPNGEQRLFVPRSGFPDLLVDTLLATEDRHFYEH
DGISLYSIGRAVLANLTAGRTVQGASTLTQQLVKNLFLSSERSYWRKANEAYMALIMDAR
YSKDRILELYMNEVYLGQSGDNEIRGFPLASLYYFGRPVEELSLDQQALLVGMVKGASIY
NPWRNPKLALERRNLVLRLLQQQQIIDQELYDMLSARPLGVQPRGGVISPQPAFMQLVRQ
ELQAKLGDKVKDLSGVKIFTTFDSVAQDAAEKAAVEGIPALKKQRKLSDLETAIVVVDRF
SGEVRAMVGGSEPQFAGYNRAMQARRSIGSLAKPATYLTALSQPKIYRLNTWIADAPIAL
RQPNGQVWSPQNDDRRYSESGRVMLVDALTRSMNVPTVNLGMALGLPAVTETWIKLGVPK
DQLNPVPAMLLGALNLTPIEVAQAFQTIASGGNRAPLSALRSVIAEDGKVLYQSFPQAER
AVPAQAAYLTLWTMQQVVQRGTGRQLGAKYPNLHLAGKTGTTNNNVDTWFAGIDGSTVTI
TWVGRDNNQPTKLYGASGAMSIYQRYLANQTPTPLNLVPPEDIADMGVDYDGNFVCSGGM
RVLPVWTSDPQSLCQQSEMQQQPSGNPFDQSSQPQQQPQQQPAQQEQKDSDGVAGWIKDM
FGSN
NT seq 2535 nt NT seq  +upstreamnt  +downstreamnt
atggccgggaatgaccgcgagccaattggacgcaaagggaaaccgacgcgtccggtcaaa
caaaaggtaagccgtcgtcgttacgaagatgacgatgattacgacgattatgatgactat
gaggatgaagaaccgatgccgcgcaaaggtaagggcaaaggcaaagggcgtaagcctcgt
ggcaaacgcggctggctatggctgctgctaaaactggctatcgtttttgccgtgctgatc
gccatttacggcgtttatctcgatcaaaaaattcgtagccgtattgatggcaaggtctgg
caattgcccgcggcagtttatggtcgaatggtcaaccttgagccagacatgaccatcagc
aagaacgagatggtgaagctgctggaggcgacccagtatcgccaggtgtcgaaaatgacc
cgtcctggcgagtttaccgtacaggccaacagcattgagatgatccgccgtccgtttgat
ttcccggacagcaaagaagggcaggtgcgcgcgcgtctgacctttgatggcgatcatctg
gcgacgatcgtcaatatggagaacaaccgtcagttcggtttcttccgtcttgatccgcgc
ctgatcaccatgatttcttcgccaaacggtgagcagcgtctgtttgtgccgcgcagtggt
ttcccggatttgctggtggatactttgctggcgacagaagaccgtcatttctacgagcat
gatgggatcagtctctactcaatcggacgtgcggtgctggcaaacctgactgccggacgc
acggtgcagggggcgagtacgctgacgcaacagttggttaaaaacctgttcctctccagc
gagcgttcttactggcgtaaagcgaacgaagcctacatggcgctgatcatggacgcgcgt
tacagcaaagaccgtattcttgagctgtatatgaacgaggtgtatctcggtcagagcggc
gacaacgaaatccgcggcttcccgctggcgagcttgtattactttggtcgcccggtagaa
gaattgagcctcgatcagcaggcgctgttggtgggtatggtgaaaggggcgtccatctac
aacccgtggcgtaacccgaaactggcgctggagcgacgtaacctggtactacgtttgctg
caacagcaacaaattattgatcaagaactctacgacatgctgagtgcgcgtccgctgggt
gttcagccgcgcggtggggtgatctctcctcagccagcctttatgcagctggtgcgtcag
gagctgcaggcgaaattaggcgataaggtaaaagatctctccggcgtgaagatcttcact
acctttgactcggtggcccaggacgcggcagaaaaagccgccgtggaaggcattccggca
ctgaagaaacagcgtaagttgagcgatcttgaaaccgcgattgtggttgttgaccgcttt
agcggtgaagttcgtgcgatggtcggtggttctgagccgcagtttgcgggctacaaccgt
gcgatgcaggcgcgtcgttcgattggttcccttgcaaaaccagcgacttatctaacggcc
ttaagccagccgaaaatctatcgtttgaatacgtggattgccgatgcgccaatcgcgctg
cgtcagccgaatggccaggtctggtcaccgcagaacgatgatcgtcgttatagcgaaagt
ggcagggtgatgctggtagatgcgttgacccgttcgatgaacgtgccgacggtgaatctg
ggcatggcgttggggctacctgcggttacggagacctggattaaactgggtgtgccgaaa
gatcaactgaatccagttccagcaatgttgttgggggcgttgaacttaacgccaatcgaa
gtggcgcaggccttccagactatcgccagcggtggtaatcgtgctccgctttccgcgcta
cgttcagtcatcgcagaagacggcaaggtgttgtatcagagcttcccgcaggcggaacgc
gctgttccggcgcaggcggcgtatctgacactatggaccatgcagcaggttgtacaacgc
ggtacgggtcgtcagcttggggcgaaatacccgaacctgcatctggcagggaaaacaggg
actaccaacaataacgtagatacctggtttgcgggcattgatgggagcacggtgaccatc
acctgggtcggccgtgataacaaccagccgaccaaactgtatggtgccagcggggcaatg
tcgatttatcagcgttatctggctaaccagacgccaacaccgctgaatcttgttccgccg
gaagatattgcagatatgggcgtggactacgacggcaactttgtttgcagcggtggtatg
cgtgtcttgccggtctggaccagcgatccgcaatcgctgtgccagcagagtgagatgcag
cagcaaccgtcaggcaatccgtttgatcagtcttctcagccgcagcaacagccgcaacag
caacctgctcagcaagagcagaaagacagcgacggtgtagccggttggattaaagatatg
tttgggagtaattaa

DBGET integrated database retrieval system