KEGG   Escherichia coli PMV-1: ECOPMV1_03649Help
Entry
ECOPMV1_03649     CDS       T02847                                 

Gene name
chiA
Definition
putative bifunctional chitinase/lysozyme precursor
Orthology
K13381  
bifunctional chitinase/lysozyme [EC:3.2.1.14 3.2.1.17]
Organism
ecoi  Escherichia coli PMV-1
Pathway
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:ecoi00520]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3727123..3729825)
Genome map
AA seq 900 aa AA seqDB search
MKLNIFTKSMIGMGLVCSALPALAMEAWNNQQGGNKYQVIFDGKIYENAWWVSSTNCPGK
AKANDATNPWRLKRTATAAEISQFGNTLSCEKSGSSSSSTSNTPASNTPANGASATPAQG
TVPSNSSVVAWNKQQGGQTWYVVFNGAVYKNAWWVASSNCPGDAKGNDASNPWRYVRAAT
ATEISETSNPQSCTSAPQPAPDVKPAPDVKPAPDVQPAPADKSNDNYAVVAWKGQEGSST
WYVIYNGGIYKNAWWVGAANCPGDAKENDASNPWRYVRAATATEITQYGNPASCSVKPDN
NGGAVTPVDPTPETPETPVTPTPDNNEPSTPADSSNDYSLQAWSGQEGSEIYHVIFNGNV
YQNAWWVGSEDCPRGTSVENSNNPWRLVRTATAAEMSQYGNPTTCEIDNGGVIIADGFQA
SKAYSANSIVDYNDAHYKTSVDQDAWGFVPGGDNPWKKYEPAKAWSASTVYVKGDRVVVD
GQAYEALFWTQSDNPALIANQNATGSNSRPWKPLGKTQSYSNEELNNAPQFNPETLYASD
TLIRFNGENYISQSKVQKVSPSDSNPWRVFVDWTGTKERVGTPKKAWPKHVYAPYVDFTL
NTIPDLAALAKSHNVNHFTLAFVVSKDANTCLPTWGTAYGMQNYAQYSKIKALREAGGDV
MLSIGGANNAPLAASCKNVDDLMQHYYDIVDNLNLRVLDFDIEGTWVADQASIERRNLAV
KKVQDKWKSEGKDIAIWYTLPILPTGLTPEGMNVLSDAKAKGVELAGVNVMTMDYGNAIC
QSANTEGQNIHGKCATSAIANLHSQLKGLHPNKSDAEIDAMMGTTPMVGVNDVQGEVFYL
SDARLVMQDAQKRNLGMVGIWSIARDLPGGTNLSPEFHGLTKEQAPKYAFSEIFAPFTKQ
NT seq 2703 nt NT seq  +upstreamnt  +downstreamnt
atgaaattaaatatatttactaaatctatgattggtatggggctggtgtgttccgctctg
ccagcattggcaatggaagcatggaataaccaacaaggtggtaataaatatcaggttatt
ttcgatggcaaaatttatgaaaatgcctggtgggtttcttctacaaattgcccgggaaaa
gcgaaagcaaatgatgcaactaacccgtggcgtttaaagcgtaccgcaacagctgctgaa
attagtcagtttggcaatacactttcctgcgaaaagagcggaagctcatcttcttcaact
tcaaatacgccagcatctaatacgcccgctaatggcgcttcggctacaccagcacagggc
actgttccgtctaattcttctgtagttgcctggaataaacagcagggcggtcaaacctgg
tatgtcgtctttaatggtgcggtatataaaaatgcttggtgggtagcctcttctaactgc
ccgggtgatgcgaaaggcaatgatgccagcaacccatggcgttatgttcgtgccgctacg
gcaacggaaatctcagaaaccagtaatccacagtcttgtacttcagcaccacagcctgca
ccggatgtgaaaccggcaccggacgttaaaccggctcctgatgttcagccagccccagct
gataagtcaaacgacaactatgctgtcgtagcctggaaaggtcaggaaggttcttctaca
tggtacgttatctacaacggcggcatttataagaacgcctggtgggtgggcgcggcaaat
tgcccaggcgatgcgaaagaaaacgatgccagcaacccatggcgttatgttcgcgcggca
acggcaacagaaatcactcagtatggtaacccagcctcctgttccgttaagccggataat
aatggcggtgctgtgactccggttgatccaactccggaaacaccggaaactccagttact
ccaactccggataacaacgagccatcaacaccagcggatagcagtaacgattactcactg
caggcgtggagtggccaggaaggcagcgaaatttaccatgttatcttcaatggtaatgtt
tatcagaatgcctggtgggttggttctgaagattgcccgcgtggcaccagtgtagaaaac
tccaataacccatggcgcctcgtgcgtacagctaccgctgcggaaatgagtcagtacggt
aacccgactacctgtgaaattgataatggcggcgtcattattgcggatggtttccaggcc
agcaaagcgtacagcgcgaacagcatcgtagattataacgatgcacattataaaacctct
gtcgatcaagacgcatggggctttgtccccggcggcgataacccgtggaagaaatacgaa
ccggcgaaagcatggtccgcttccaccgtgtacgtgaaaggtgatcgcgttgttgttgat
gggcaggcttatgaagcgctgttctggacgcaaagtgacaaccctgctctgattgcgaac
caaaacgccaccggtagcaatagtcgcccgtggaagccgttaggtaagactcagagctat
agcaacgaagagctgaataatgcgccgcagtttaatccagaaacgctttatgccagtgat
acgctgattcgctttaacggtgagaactacatttctcagagtaaagtgcagaaagtttct
ccttctgacagcaacccgtggcgtgtttttgttgactggaccggaaccaaagagcgcgta
ggtacgccgaagaaagcgtggccgaaacacgtttatgcaccgtatgtcgactttacgctg
aatacgatcccggatttggctgcgctggctaagagtcataacgtcaaccacttcacgctg
gcgtttgtggtgagtaaagatgcgaacacctgtctaccgacatggggtaccgcttacggt
atgcagaattacgctcagtacagcaaaatcaaagctctgcgtgaggctggcggtgatgtg
atgctgtctatcggtggtgctaataatgccccgctggcagcttcctgtaagaacgttgac
gatctaatgcagcattattatgacatcgttgataacctgaacctcagagtcctggacttc
gatatcgaaggcacctgggttgcggatcaggcatctattgaacgtcgtaaccttgctgtg
aagaaagtgcaggataaatggaagtcagaaggcaaagatattgctatctggtataccttg
ccaattctgccgacaggcctgacgccggaagggatgaatgtcctgagcgatgccaaagcg
aaaggtgttgagctggcgggtgtgaacgtgatgacaatggactacggtaacgcgatttgt
cagtctgcaaataccgaaggccagaacattcacggtaagtgtgcaacgtctgcgattgcc
aacctgcattcacaattgaaaggcctccatcccaacaagagcgatgcagaaattgacgct
atgatgggtaccacgccgatggttggcgtgaacgacgttcagggcgaggtgttctatctc
tctgatgctcgtctggtcatgcaggatgcgcagaagcgtaatctcggtatggttggtatc
tggtcaatcgcgcgcgacctgccaggcggcactaacctgtctccggaattccacggcctg
actaaagaacaggcaccgaagtacgcatttagcgaaatcttcgcgccgtttactaagcaa
taa

DBGET integrated database retrieval system