KEGG   Escherichia coli PMV-1: ECOPMV1_03863Help
Entry
ECOPMV1_03863     CDS       T02847                                 

Gene name
bcsZ
Definition
Endoglucanase precursor (EC:3.2.1.4)
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
ecoi  Escherichia coli PMV-1
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:ecoi00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3957737..3958843)
Genome map
AA seq 368 aa AA seqDB search
MNVLRSGLVTMLLLAAFSVQAACTWPAWEQFKKDYISQEGRVIDPSDARKITTSEGQSYG
MFFALAANDRAAFDNLLDWTQNNLAQGSLKEHLPAWLWGKKENSKWEVLDSNSASDGDVW
MAWSLLEAGRLWKEQRYTDIGSALLKRIAREEVVTVPGLGSMLLPGKVGFAEDNSWRFNP
SYLPPTLAQYFTRFGAPWTTLRETNQRLLLETAPKGFSPDWVRYEKDKGWQLKAEKTLIS
SYDAIRVYMWVGMMPDSDPQKARMLNRFKPMATFTEKNGYPPEKVDVATGKAQGKGPVGF
SAAMLPFLQNRDAQAVQRQRVADNFPGSDAYYNYVLTLFGQGWDQHRFRFSTKGELLPDW
GQECANSH
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atgaatgtgttgcgtagtggactcgtgacgatgctgctgctggctgcctttagtgttcag
gcagcctgtacctggcctgcctgggagcagtttaaaaaggattacatcagtcaggaaggg
cgcgtcatcgaccccagcgacgcgcgcaaaatcaccacctccgaagggcaaagttacggc
atgttctttgccctggcggctaacgaccgtgcagctttcgataatcttctcgactggacg
cagaacaatctcgctcagggttctttaaaagaacatttgcccgcctggctgtggggcaag
aaagagaacagtaagtgggaagtgctggacagcaattcggcctccgatggtgatgtctgg
atggcctggtcgttgctggaggcggggcgtttgtggaaagagcagcgttataccgacatc
ggcagcgcattgctaaaacgtatcgcgcgggaggaagtggtgacggtgcctgggctgggc
tccatgttgttaccgggcaaagtgggttttgctgaggataacagctggcgttttaacccc
agctacctgccgccgacgctggcgcagtatttcacccgctttggcgcgccgtggaccacg
ctgcgcgaaaccaatcaacgtttattgctggaaaccgccccgaaaggcttttcgccagac
tgggtgcgctatgagaaagacaaaggctggcagctaaaagccgaaaaaacattgatcagc
agctacgacgctatccgcgtttacatgtgggtaggcatgatgcctgacagcgatccgcaa
aaagcgcggatgctcaaccggtttaaaccgatggcgacattcactgagaaaaacggttat
ccgccggaaaaagtggatgtggctacggggaaagcgcagggtaaaggaccggtcggtttt
tctgccgccatgctgccctttttacaaaaccgcgatgcgcaggccgttcagcgccagcgc
gtggccgataactttcccggcagcgatgcctattacaactatgtgctgaccctgtttgga
caaggctgggatcaacaccgtttccgcttctcgacaaaaggtgagttattacctgactgg
ggccaggaatgcgcaaattcacactaa

DBGET integrated database retrieval system