KEGG   Escherichia coli PMV-1: ECOPMV1_03909Help
Entry
ECOPMV1_03909     CDS       T02847                                 

Gene name
malS
Definition
Alpha-amylase precursor (EC:3.2.1.1)
Orthology
K01176  
alpha-amylase [EC:3.2.1.1]
Organism
ecoi  Escherichia coli PMV-1
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:ecoi00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4005224..4007254
Genome map
AA seq 676 aa AA seqDB search
MKLAACFLTLLPGFAVAASWTSPGFPAFSEQGTGTFVSHAQLPKGTRPLTLNFDQQCWQP
ADAIKLNQMLSLQPCSNTPPQWRLFRDGEYTLQLDTRSGTPTLMISLQNTVEPVASLVRE
CPKWDGLPLTLDVSATFAEGAAVRDYYSQQIAIVKNGQITLQPAATSNGLLLLERAETDT
SAPFDWHNATVYFVLTDRFENGDPSNDQSYGRHKDGMAEIGTFHGGDLRGLTNKLDYLQQ
LGVNALWISAPFEQIHGWVGGGTKGDFPHYAYHGYYTQDWTNLDANMGSEADLRTLVDSA
HQRGIRILFDIVMNHTGYATLADMQEYQFGALYLSGDELKKTLGERWSDWKPAAGQTWHS
FNDYINFSDKTGWDKWWGKNWIRTDIGDYDNPGFDDLTMSLAFLPDIKTESTTASGLPVF
YKNKTDTHAKVIDGFTPRDYLTHWLSQWVRDYGIDGFRVDTAKHVELPAWQQLKTEASAA
LREWKKANPDKALDDKPFWMTGEAWGHGVMQSDYYRHGFDAMINFDYQEQAAKAVDCLAQ
MDTTWQQMAEKLQDFNVLSYLSSHDTRLFREGGDKAAELLLLAPGAVQIFYGDESSRPFG
PTGSDPLQGTRSDMNWQDVSGKSAASVAHWQKISQFRARHPAIGAGKQTTLSLKQGYGFV
REHGDDKVLVIWAGQQ
NT seq 2031 nt NT seq  +upstreamnt  +downstreamnt
atgaaactcgccgcctgttttctgacactccttcctggcttcgccgttgccgccagctgg
acttctccggggtttcccgcctttagcgaacaggggacgggaacatttgtcagccacgcg
cagttgcccaaaggtacgcgtccactaacgctaaattttgaccaacagtgctggcagcct
gcggatgcgataaaactcaatcagatgctttccctgcaaccttgtagcaacacgccacct
caatggcgattgttcagggacggcgaatatacgctgcaactagacacccgctccggtacg
ccaacattgatgatttccctccagaacaccgtcgaaccggtagcaagcctggtccgtgaa
tgcccgaaatgggatggattaccgctcacactggatgtcagcgccacttttgcggaggga
gccgccgtccgggattattacagccagcaaattgcgatagtgaagaacggtcaaataacg
ttacaacccgctgccaccagcaacggtttactcctgctggaacgggcagaaactgacaca
tccgcccctttcgactggcataacgccacggtttactttgtgctgacagatcgtttcgaa
aacggcgatcccagtaatgaccagagttacggacgtcataaagacggtatggcggaaatt
ggcacttttcacggcggcgatttacgcggcctgaccaacaaactggattatctccagcag
ttgggcgttaatgctttatggataagcgccccatttgagcaaattcacggctgggtcggc
ggcggtacaaaaggtgatttcccgcattatgcctatcatggttattacactcaggactgg
acgaatcttgatgccaatatgggcagtgaagccgatctacggacgctggttgatagcgcg
catcagcgcggtattcgtattctctttgatatcgtgatgaaccacactggctatgccacg
ctggcggatatgcaggagtatcagtttggcgcgttatatctttctggtgacgagctgaaa
aaaacgctgggtgaacgctggagcgactggaaacctgccgccgggcaaacctggcatagc
tttaacgattacattaatttcagcgacaaaacaggctgggataaatggtggggaaaaaac
tggatcagaacggatatcggcgattacgacaatcctggattcgacgatctcactatgtcg
ctggcctttttgccggatatcaaaaccgaatcaactaccgcttctggtctgccagtgttc
tataaaaacaaaacggatacccacgctaaagtcatcgacggctttacccctcgcgattac
ttaacccactggttaagtcagtgggtccgcgactatgggattgatggttttcgggtcgat
accgccaaacatgttgagttgcccgcctggcagcaactgaaaaccgaagccagcgctgca
cttcgcgaatggaaaaaagctaaccccgacaaagcattagatgacaaacctttctggatg
accggtgaagcctggggccacggcgtgatgcaaagtgactactatcgccacggcttcgat
gcgatgatcaatttcgattatcaggagcaggcggcgaaagcagtcgattgtctggcgcag
atggatacgacctggcagcaaatggcggagaaattgcaggatttcaacgtgttgagctac
ctctcgtcgcatgatacccgcctgttccgtgaagggggcgacaaagcagcagagttatta
ttattagcgccaggcgcggtacaaatcttttatggcgatgaatcctcgcgtccgttcggt
cctaccggttctgatccgctgcaaggtacgcgttcggatatgaactggcaggatgttagc
ggtaaatctgccgccagcgtcgcgcactggcagaaaatcagccagttccgcgcccgccat
cccgcaattggcgcgggcaaacaaacgacactttcgctgaagcagggctacggctttgtt
cgtgagcatggcgacgataaagtgctggtcatctgggctgggcaacagtga

DBGET integrated database retrieval system