KEGG   Escherichia coli PMV-1: ECOPMV1_04090Help
Entry
ECOPMV1_04090     CDS       T02847                                 

Gene name
rbsK_2
Definition
Ribokinase (EC:2.7.1.15)
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
ecoi  Escherichia coli PMV-1
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:ecoi00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    ECOPMV1_04090 (rbsK_2)
Enzymes [BR:ecoi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     ECOPMV1_04090 (rbsK_2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4199885..4200814
Genome map
AA seq 309 aa AA seqDB search
MQNAGSLVVLGSINADHILNLQSFPTPGETVTGNHYQVAFGGKGANQAVAAGRSGANIAF
IACTGDDSIGESVRQQLATDNIDISPVSVIKGESTGVALIFVNGEGENVIGIHAGANAAL
SPALVEAQRERIANASALLMQLESPLESVMAAAKIAHQNKTIVALNPAPARELPDELLAL
VDIITPNETEAEKLTGIRVENDEDAAKAAQVLHEKGIRTVLITLGSRGVWASVNGEGQRV
PGFRVQAVDTIAAGDTFNGALITALLEEKPLPEAIRFAHAAAAIAVTRKGAQPSVPWREE
IDAFLDRQR
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaacgcaggcagcctcgttgttcttggcagcattaatgctgaccacattcttaat
cttcaatcttttcctactccaggcgaaaccgtaaccggtaaccactatcaggttgcattt
ggcggcaaaggcgcgaatcaagctgtggctgctgggcgtagcggtgcgaatatcgcgttt
attgcctgtacgggtgatgacagcattggcgagagcgtacgtcagcagctcgccactgat
aacatcgatatttctccggtcagcgtgatcaaaggcgaatcaacaggtgtggcgctgatt
tttgttaatggtgaaggtgagaatgtcatcggtattcatgccggcgctaatgctgccctt
tccccggcgctggtggaagcgcaacgtgagcgtattgccaacgcgtcggcattattaatg
cagctggaatcaccactcgaaagtgtgatggcagcggcgaaaatcgcccatcaaaataag
actatcgttgcgcttaacccggctccggctcgcgaacttcctgacgaacttctggcgctg
gtggacattattacgccaaacgaaacggaagcagaaaagctcaccggtattcgtgttgaa
aatgatgaagatgcagcgaaggcggcgcaggtactgcatgaaaaaggtatccgtactgta
ctgattactttaggaagtcgtggtgtatgggctagcgtgaatggtgaaggtcagcgcgtt
cctggattccgggtgcaggctgtcgataccattgctgccggagatacctttaacggcgcg
ttaatcacggcgttgctggaagaaaaaccattgccagaggcgattcgttttgcccatgca
gccgctgcgattgccgtaacacgtaaaggcgcacaaccttccgtaccgtggcgtgaagag
atcgacgcatttttagacaggcagaggtga

DBGET integrated database retrieval system