KEGG   Escherichia coli JJ1886: P423_10490Help
Entry
P423_10490        CDS       T02896                                 

Definition
alpha-amylase (EC:3.2.1.1)
Orthology
K01176  
alpha-amylase [EC:3.2.1.1]
Organism
ecoj  Escherichia coli JJ1886
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ecoj00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    P423_10490
Enzymes [BR:ecoj01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     P423_10490
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2103108..2104595
Genome map
AA seq 495 aa AA seqDB search
MRNPTLLQCFHWYYPEGGKLWPELAERADGFNDIGINMVWLPPAYKGASGGYSVGYDSYD
LFDLGEFDQKGSIPTKYGDKAQLLAAIDALKRNDIAVLLDVVVNHKMGADEKEAIRVQRV
NADDRTQIDEEIIECEGWTRYTFPARAGQYSQFIWDFKCFSGIDHIENPDEDGIFKIVND
YTGEGWNDQVDDELGNFDYLMGENIDFRNHAVTEEIKYWARWVMEQTQCDGFRLDAVKHI
PAWFYKEWIEHVQEVAPKPLFIVAEYWSHEVDKLQTYIDQVEGKTMLFDAPLQMKFHEAS
RMGRDYDMTQIFTGTLVEADPFHAVTLVANHDTQPLQALEAPVEPWFKPLAYALILLREN
GVPSVFYPDLYGAHYEDVGGDGQTYPIDMPIIEQLDELILARQRFAHGVQTLFFDHPNCI
AFSRSGTDEYPGCVVVMSNGDDGEKTIHLGENYGNKTWRDFLGNRQESVVTDENGEATFF
CNGGSVSVWVIEEVI
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atgcgtaatcccacgctgttacaatgttttcactggtattacccggaaggcggtaagctc
tggcctgaactggccgagcgcgcagacggttttaatgatattggtatcaatatggtctgg
ttgccgcccgcctataaaggcgcatcgggcggctattcggtcggctacgactcctatgat
ttatttgatctaggtgagtttgatcagaaaggcagcatccctactaaatatggtgataaa
gcacaactgctggccgccattgacgccctgaaacgtaatgacattgcggtgctgctggac
gtggtagtcaaccacaaaatgggcgcggatgaaaaagaagctattcgcgtgcagcgtgta
aatgctgatgaccgtacgcaaattgacgaagaaatcattgagtgtgaaggctggacgcgt
tacaccttccccgctcgtgccgggcaatactcgcagtttatctgggatttcaaatgtttt
agcggtatcgaccatatcgaaaaccctgatgaagatggcatttttaaaattgttaacgac
tataccggagaaggctggaacgatcaggttgatgatgaactcggtaatttcgattatctg
atgggggagaatatcgattttcgcaatcatgccgtgacggaagagattaaatactgggcg
cgctgggtgatggaacaaacgcaatgcgacggctttcgtcttgatgcggtcaaacatatt
ccggcatggttttataaagagtggatcgaacacgtacaggaagttgcgccaaagccgttg
tttattgtggctgaatactggtcgcatgaagtcgataaactgcaaacgtatattgatcag
gtggaaggcaaaaccatgctgtttgatgcgccgctgcagatgaaattccatgaagcatcg
cgcatgggtcgcgactacgacatgacgcagatcttcactgggacgctggtggaagccgat
ccttttcacgccgtaaccctcgttgccaaccacgacacccaaccgttgcaagccctcgaa
gcccccgtcgaaccgtggtttaaaccgctggcgtatgccttaattttgttgcgggaaaat
ggcgttccttcggtgttctatccggacctctacggtgcacattacgaagatgtcggtggt
gacgggcaaacctatccgatagatatgccaataatcgaacagcttgatgagttaattctc
gcccgtcagcgtttcgcccacggtgtacagacgttatttttcgaccatccgaactgcatt
gcctttagccgcagtggcaccgacgaatatcccggctgcgtggtggtcatgtcgaacgga
gatgatggcgaaaaaaccattcatctgggagagaattacggcaataaaacctggcgcgat
tttctggggaaccggcaagagagcgtagtgacagacgaaaacggcgaagcgaccttcttt
tgcaacggcggcagcgtcagcgtgtgggttatcgaagaggtgatttaa

DBGET integrated database retrieval system