KEGG   Escherichia coli JJ1886: P423_15185Help
Entry
P423_15185        CDS       T02896                                 

Definition
(GenBank) glycosyl hydrolase family 32
  KO
K01193  
beta-fructofuranosidase [EC:3.2.1.26]
Organism
ecoj  Escherichia coli JJ1886
Pathway
Galactose metabolism
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ecoj00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    P423_15185
   00500 Starch and sucrose metabolism
    P423_15185
Enzymes [BR:ecoj01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     P423_15185
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
3087886..3089289
Genome map
AA seq 467 aa AA seqDB search
MPSQMPAILQAVMKGQSKALADAHYPCWHLAPVTGLMNDPNGFCWSGGRYHLFYQWNPLA
CDHKYKCWGHWSSTDLLHWQHEPLALMPDKEYDRNGCYSGSAVNNQGVLTLCYTGNVKFD
DGSRTAWQCLATENNQGGFDKLGPVIPLPDGYTGHVRDPKVWKHNSQWYMVLGAQDKEKR
GKVLLYSSVDLYTWSFHGEIAGNGLNEIDNAGYMWECPDLFALDGEYILLCCPQGMAREH
ERYLNTYPCAWLHGQFDYETGKFTHGAFSELDAGFEFYAPQTMEAPDGRRLLVGWMGVPD
GEEMLQPTRKHHWQHQMTCFRELSFQKGKLFQMPIRELAQLREAEHFWQGKADHAPHVEI
ERLEMDIIPSGELYLNFGNALALHLNDDGIQLQRRSLAGQEKLTRYWRGSVTSLKILCDS
SSVEIFINNGEGVMSNRYFPHHPASLILQGESDVTLRYWSLRACMVE
NT seq 1404 nt NT seq  +upstreamnt  +downstreamnt
atgccttcacaaatgcccgcgattttacaggcagtgatgaaaggtcagtccaaagcactg
gcagatgcccactatccttgttggcatctcgctccagtcaccggactaatgaacgatcca
aatggcttttgttggtctggaggccgctatcatctgttttatcaatggaatccactggct
tgtgatcataagtacaaatgttgggggcactggagttcgacggatttattgcactggcag
catgaaccattagcgctaatgcccgataaagagtacgaccgtaatggttgttactcagga
agcgcggttaataatcagggcgttctcacactttgctataccggtaatgttaagtttgat
gatggcagcagaacagcatggcaatgtctggccaccgaaaataaccagggcgggtttgat
aaactaggccctgtcataccgttacctgatggttacaccggacatgttcgtgatccaaaa
gtctggaagcacaacagccaatggtacatggtgcttggcgcgcaagataaagagaaacgg
gggaaagtactgctgtattcctctgtcgatctctatacctggtcttttcatggagaaatt
gctggtaatggtctgaatgaaatagataacgcaggatacatgtgggaatgtcctgatctt
ttcgcccttgatggtgaatacattctcctctgctgcccccagggaatggcgcgcgaacat
gagcgctatctgaatacttatccctgcgcctggctacatggacagtttgattacgagaca
ggcaagtttacgcatggcgctttctcagagctggatgcgggatttgaattctatgcacca
cagacgatggaagccccggacgggcgacgattgctggtcggctggatgggggttcctgat
ggcgaagagatgttgcaaccaaccagaaagcatcattggcagcatcaaatgacctgtttt
cgcgaactctcattccagaagggaaaattgtttcagatgccaatcagggaactcgcgcaa
ctgcgtgaagctgaacacttctggcaaggaaaagcggatcatgcgccgcatgtcgaaatt
gaacgcctggaaatggacatcattccgtcgggtgagctgtatctgaattttggcaatgcg
ctggcactgcatcttaatgacgatggtattcaactacagaggagaagccttgcagggcaa
gagaaactaactcgttactggcgaggaagcgtaacgtcactgaagattctctgtgacagt
tccagcgtagagatattcatcaataatggtgaaggtgtaatgagtaatcgttattttccc
catcatccagcttcgctgatattacagggtgagtctgacgtcacgttacgctactggtcg
ctacgcgcctgcatggtagaatga

DBGET integrated database retrieval system