KEGG   Escherichia coli JJ1886: P423_20805Help
Entry
P423_20805        CDS       T02896                                 

Definition
ribokinase (EC:2.7.1.15)
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
ecoj  Escherichia coli JJ1886
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:ecoj00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    P423_20805
Enzymes [BR:ecoj01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     P423_20805
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4275773..4276717
Genome map
AA seq 314 aa AA seqDB search
MDIPNMQNAGSLVVLGSINADHILNLQSFPTPGETVTGNHYQVAFGGKGANQAVAAGRSG
ANIAFIACTGDDSIGESVRQQLATDNIDISPVSVIKGESTGVALIFVNGEGENVIGIHAG
ANAALSPALVEAQRERIANASALLMQLESPLESVMAAAKIAHQNKTIVALNPAPARELPD
ELLALVDIITPNETEAEKLTGIRVENDEDAAKAAQVLHEKGIRTVLITLGSRGVWASVNG
EGQRVPGFRVQAVDTIAAGDTFNGALITALLEEKTLPEAIRFAHAAAAIAVTRKGAQPSV
PWREEIDAFLDRQR
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atggacatcccgaatatgcaaaacgcaggcagcctcgttgttcttggcagcattaatgct
gaccacattcttaatcttcaatcttttcctactccaggcgaaaccgtaaccggtaaccac
tatcaggttgcatttggcggcaaaggcgcgaatcaggcggtggctgctgggcgtagcggt
gcgaatatcgcgtttattgcctgcactggcgatgacagcattggtgagagcgttcgccag
cagctcgccactgataatatcgatatttctccggtcagcgtgatcaaaggcgaatcaaca
ggtgtggcgctgatttttgttaatggcgaaggtgagaatgtcatcggtattcatgccggc
gctaatgctgccctttccccggcgctggtggaagcgcaacgtgagcgtattgccaacgcg
tcggcattattaatgcagctggaatcaccactcgaaagtgtgatggcagcggcgaaaatc
gcccatcaaaataagactatcgttgcgcttaacccggctccggctcgcgaacttcctgac
gaacttctggcgctggtggacattattacgccaaacgaaacggaagcagaaaagctcacc
ggtattcgtgttgaaaatgatgaagatgcagcgaaggcggcgcaggtactgcatgaaaaa
ggtatccgtactgtactgattactttaggaagtcgtggtgtatgggctagcgtgaatggt
gaaggtcagcgcgttcctggattccgggtgcaggctgtcgataccattgctgccggagat
acctttaacggcgcgttaatcacggcgttgctggaagaaaaaacattgccagaggcgatt
cgttttgcccatgcagccgctgcgattgccgtaacacgtaaaggcgcacaaccttccgta
ccgtggcgtgaagagatcgacgcatttttagacaggcagaggtga

DBGET integrated database retrieval system