KEGG   Escherichia coli K-12 MDS42: ECMDS42_2305Help
Entry
ECMDS42_2305      CDS       T02541                                 

Gene name
fucA
Definition
L-fuculose-1-phosphate aldolase
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
ecok  Escherichia coli K-12 MDS42
Pathway
Fructose and mannose metabolism
Class
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:ecok00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(2443576..2444223)
Genome map
AA seq 215 aa AA seqDB search
MERNKLARQIIDTCLEMTRLGLNQGTAGNVSVRYQDGMLITPTGIPYEKLTESHIVFIDG
NGKHEEGKLPSSEWRFHMAAYQSRPDANAVVHNHAVHCTAVSILNRSIPAIHYMIAAAGG
NSIPCAPYATFGTRELSEHVALALKNRKATLLQHHGLIACEVNLEKALWLAHEVEVLAQL
YLTTLAITDPVPVLSDEEIAVVLEKFKTYGLRIEE
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
atggaacgaaataaacttgctcgtcagattattgacacttgcctggaaatgacccgcctg
ggactgaaccaggggacagcggggaacgtcagtgtacgttatcaggatgggatgctgatt
acgcctacaggcattccatatgaaaaactgacggagtcgcatattgtctttattgatggc
aacggtaaacatgaggaaggaaagctcccctcaagcgaatggcgtttccatatggcagcc
tatcaaagcagaccggatgccaacgcggttgttcacaatcatgccgttcattgcacggca
gtttccattcttaaccgatcgatccccgctattcactacatgattgcggcggctggcggt
aattctattccttgcgcgccttatgcgacctttggaacacgcgaactttctgaacatgtt
gcgctggctctcaaaaatcgtaaggcaactttgttacaacatcatgggcttatcgcttgt
gaggtgaatctggaaaaagcgttatggctggcgcatgaagttgaagtgctggcgcaactt
tacctgacgaccctggcgattacggacccggtgccagtgctgagcgatgaagagattgcc
gtagtgctggagaaattcaaaacctatgggttacgaattgaagagtaa

DBGET integrated database retrieval system