KEGG   Escherichia coli LY180: LY180_00725Help
Entry
LY180_00725       CDS       T02846                                 

Gene name
mrcB
Definition
bifunctional glycosyl transferase/transpeptidase
Orthology
K05365  
penicillin-binding protein 1B [EC:2.4.1.129 3.4.-.-]
Organism
ecol  Escherichia coli LY180
Pathway
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:ecol00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    LY180_00725 (mrcB)
Enzymes [BR:ecol01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.129  peptidoglycan glycosyltransferase
     LY180_00725 (mrcB)
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.-  Acting on peptide bonds (peptidases)
    3.4.-.-  
     LY180_00725 (mrcB)
Glycosyltransferases [BR:ecol01003]
 Polysaccharide
  Bacterial polysaccharide
   LY180_00725 (mrcB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
166086..168620
Genome map
AA seq 844 aa AA seqDB search
MAGNDREPIGRKGKPTRPVKQKVSRRRYEDDDDYDDYDDYEDEEPMPRKGKGKGKGRKPR
GKRGWLWLLLKLAIVFAVLIAIYGVYLDQKIRSRIDGKVWQLPAAVYGRMVNLEPDMTIS
KNEMVKLLEATQYRQVSKMTRPGEFTVQANSIEMIRRPFDFPDSKEGQVRARLTFDGDHL
ATIVNMENNRQFGFFRLDPRLITMISSPNGEQRLFVPRSGFPDLLVDTLLATEDRHFYEH
DGISLYSIGRAVLANLTAGRTVQGASTLTQQLVKNLFLSSERSYWRKANEAYMALIMDAR
YSKDRILELYMNEVYLGQSGDNEIRGFPLASLYYFGRPVEELSLDQQALLVGMVKGASIY
NPWRNPKLALERRNLVLRLLQQQQIIDQELYDMLSARPLGVQPRGGVISPQPAFMQLVRQ
ELQAKLGDKVKDLSGVKIFTTFDSVAQDAAEKAAVEGIPALKKQRKLSDLETAIVVVDRF
SGEVRAMVGGSEPQFAGYNRAMQARRSIGSLAKPATYLTALSQPKIYRLNTWIADAPIAL
RQPNGQVWSPQNDDRRYSESGRVMLVDALTRSMNVPTVNLGMALGLPAVTETWIKLGVPK
DQLHPVPAMLLGALNLTPIEVAQAFQTIASGGNRAPLSALRSVIAEDGKVLYQSFPQAER
AVPAQAAYLTLWTMQQVVQRGTGRQLGAKYPNLHLAGKTGTTNNNVDTWFAGIDGSTVTI
TWVGRDNNQPTKLYGASGAMSIYQRYLANQTPTPLNLVPPEDIADMGVDYDGNFVCSGGM
RVLPVWTSDPQSLCQQSEMQQQPSGNPFDQSSQPQQQPQQQPAQQEQKDSDGVAGWIKDM
FGSN
NT seq 2535 nt NT seq  +upstreamnt  +downstreamnt
atggccgggaatgaccgcgagccaattggacgcaaagggaaaccgacgcgtccggtcaaa
caaaaggtaagccgtcgtcgttacgaagatgacgatgattacgacgattatgatgactat
gaggatgaagaaccgatgccgcgcaaaggtaagggcaaaggcaaagggcgtaagcctcgt
ggcaaacgcggctggctatggctactgctaaaactggctatcgtttttgccgtgctgatc
gccatttacggcgtttatctcgatcaaaaaattcgtagccgtattgatggcaaggtctgg
caactgcctgcggcagtttatggccgaatggtcaatcttgagccagacatgaccatcagc
aagaacgagatggtgaagctgctggaggcgacccagtatcgtcaggtgtcgaaaatgacc
cgtcctggcgaatttaccgtgcaggccaacagcattgagatgattcgccgtccgtttgat
ttcccggacagtaaagaaggacaggtgcgcgcgcgtctgacctttgatggcgatcatctg
gcgacgatcgtcaatatggagaacaaccgtcagttcggtttcttccgtcttgatccgcgt
ctgatcaccatgatctcttcgccaaacggtgagcagcgtctgtttgtgccgcgcagtggt
ttcccggatttgctggtggatactttgctggcgacagaagaccgtcatttttacgagcat
gatggaatcagtctctactcaatcggacgtgcggtgctggcaaacctgaccgccggacgc
acggtacagggtgcgagtacgctgacgcaacagctggtgaaaaacctgttcctctccagc
gagcgttcttactggcgtaaagcgaacgaagcttacatggcgctgatcatggacgcgcgt
tacagcaaagaccgtattcttgagctgtatatgaacgaggtgtatctcggtcagagcggc
gacaacgaaatccgcggcttcccgctggcaagcttgtattactttggtcgcccggtagaa
gagctaagcctcgaccagcaggcgctgttagtcggtatggtgaaaggggcgtccatctac
aacccgtggcgtaacccaaaactggcgctggagcgacgtaatctggtgctgcgtctgctg
caacagcaacagattattgatcaagaactctatgacatgttgagtgcacgtccgctgggt
gttcagccacgcggtggggtgatctctccacagccagcctttatgcaactggtgcgtcag
gagctgcaggcgaaattaggcgataaggtaaaagatctctccggcgtgaagatcttcact
acctttgactcggtggcccaggacgcggcagaaaaagccgccgtggaaggcattccggca
ctgaagaaacagcgtaagttgagcgatcttgaaactgcgattgtggtcgtcgaccgcttt
agtggtgaagttcgtgcgatggtcggtggttctgagccgcagtttgcgggctacaaccgt
gcgatgcaggcgcgtcgttcgattggttcccttgcaaaaccagcgacttatctgactgcc
ttaagccagccgaaaatctatcgtctgaatacgtggattgcggatgcgccaatcgcgctg
cgtcagccgaatggccaggtctggtcaccgcagaatgatgaccgtcgttatagcgaaagc
ggcagagtgatgctggtggatgcgttgacccgttcgatgaacgtgccgacggtaaatctg
gggatggcgctggggctgcctgcggttacggagacctggatcaaactgggcgtaccgaaa
gatcagttgcatccggttccggcgatgctgctgggggcgttgaacttaacgccaatcgaa
gtggcgcaggcgttccagaccatcgccagcggcggtaaccgtgcaccgctttctgcactg
cgttcggtaattgcggaagatggcaaggtgctgtatcagagcttcccgcaggcggaacgc
gctgttccggcgcaggcggcgtatctgacactatggaccatgcagcaggtggtacaacgc
ggtacgggtcgtcagcttggggcgaaatacccgaacctgcatctggcagggaaaacaggg
actaccaacaataacgtagatacctggtttgcaggcattgacggcagcacggtgaccatc
acctgggtaggccgtgataacaaccagccgaccaaactgtatggagccagcggggcaatg
tcgatttatcagcgttatctggctaaccagacgccaacgccgctgaatcttgttccgcca
gaagatattgcagatatgggcgtggactacgacggcaactttgtttgcagcggtggcatg
cgtgtcttgccggtctggaccagcgatccgcaatcgctgtgccagcagagcgagatgcag
cagcagccgtcaggcaatccgtttgatcagtcttctcagccgcagcaacagccgcaacag
caacctgctcagcaagagcagaaagacagcgacggtgtagccggttggatcaaggatatg
tttggtagtaattaa

DBGET integrated database retrieval system