KEGG   Escherichia coli LY180: LY180_02240Help
Entry
LY180_02240       CDS       T02846                                 

Definition
alkaline phosphatase
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
ecol  Escherichia coli LY180
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:ecol00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    LY180_02240
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    LY180_02240
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    LY180_02240
Enzymes [BR:ecol01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     LY180_02240
Exosome [BR:ecol04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   LY180_02240
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
471544..472836
Genome map
AA seq 430 aa AA seqDB search
MIFTKIIRGFISALRDSLSDKPAKNIILLIGDGMGDSEITAARNYAEGAGGFFKGIDALP
LTGQYTHYALNKKTGKPDYVTDSAASATAWSTGVKTYNGALGVDIHEKDHPTILEMAKAA
GLATGNVSTAELQDATPAALVAHVTSRKCYGPSATSEKCPGNALEKGGKGSITEQLLNAR
ADVTLGGGAKTFAETATAGEWQGKTLREQAQARGYQLVNDAASLNSVTEANQQKPLLGLF
ADGNMPVRWLGPKATYHGNIDKPAVTCTPNPQRNDSVPTLAQMTDKAIELLSKNEKGFFL
QVEGASIDKQDHAANPCGQIGETVDLDEAVQRALEFAKKEGNTLVIVTADHAHASQVVAP
DTKAPGLTQALNTKDGAVMVMSYGNSEEDSQEHTGSQLRIAAYGPHAANVVGLTDQTDLF
YTMKAALGLK
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atgatttttaccaaaatcattaggggattcatcagcgctctgcgtgattctcttagcgat
aaacctgcaaaaaatattattttgctgattggcgatgggatgggggattcggaaattact
gccgcacgtaattatgccgaaggtgcgggcggcttttttaaaggtatcgatgccttaccg
cttaccgggcaatacactcactatgcgctgaataaaaaaactggcaaaccggactacgtc
accgactcggctgcatcagcaaccgcctggtcaaccggtgtcaaaacctataacggcgcg
ctgggcgtcgatattcacgaaaaagatcacccaacgattctggaaatggcaaaagccgca
ggtctggcgaccggtaacgtttctaccgcagagttgcaggatgccacgcccgctgcgctg
gtggcacatgtgacttcgcgcaaatgctacggtccgagcgcgaccagtgaaaaatgtccg
ggtaacgctctggaaaaaggcggaaaaggatcgattaccgaacagctgcttaacgctcgt
gccgacgttacgcttggcggcggcgcaaaaacctttgctgaaacggcaaccgctggtgaa
tggcagggaaaaacgctgcgtgaacaggcacaggcgcgtggttatcagttggtgaacgat
gctgcctcactgaattcggtgacggaagcgaatcagcaaaaacccctgcttggcctgttt
gctgacggcaatatgccagtgcgctggctagggccgaaagcaacgtaccacggcaatatc
gataagcccgcagtcacctgtacgcctaatccgcaacgtaatgacagtgtaccaaccctg
gcacagatgaccgacaaagccattgaattgttgagtaaaaatgagaaaggatttttcctg
caagttgaaggtgcgtcaatcgataaacaggatcacgctgcgaatccttgtgggcaaatt
ggcgagacggtcgatctcgatgaagccgtacaacgggcgctggaattcgctaaaaaggag
ggtaacacgctggtcatagtcaccgctgatcacgcccacgccagccaggttgttgcgccg
gataccaaagcgccgggcctcactcaggcgctaaatactaaagatggcgcagtgatggtg
atgagttacgggaactctgaagaggattcacaagaacataccggcagtcagttgcgtatt
gcggcgtatggcccgcatgccgccaatgttgttggactgaccgaccagaccgatctcttc
tacaccatgaaagccgctctggggctgaaataa

DBGET integrated database retrieval system