KEGG   Escherichia coli LY180: LY180_06300Help
Entry
LY180_06300       CDS       T02846                                 

Definition
(GenBank) bifunctional acetaldehyde-CoA/alcohol dehydrogenase
  KO
K04072  acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
ecol  Escherichia coli LY180
Pathway
ecol00010  Glycolysis / Gluconeogenesis
ecol00071  Fatty acid degradation
ecol00350  Tyrosine metabolism
ecol00620  Pyruvate metabolism
ecol00625  Chloroalkane and chloroalkene degradation
ecol00626  Naphthalene degradation
ecol00650  Butanoate metabolism
ecol01100  Metabolic pathways
ecol01110  Biosynthesis of secondary metabolites
ecol01120  Microbial metabolism in diverse environments
ecol01130  Biosynthesis of antibiotics
ecol01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:ecol00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LY180_06300
   00620 Pyruvate metabolism
    LY180_06300
   00650 Butanoate metabolism
    LY180_06300
  Lipid metabolism
   00071 Fatty acid degradation
    LY180_06300
  Amino acid metabolism
   00350 Tyrosine metabolism
    LY180_06300
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    LY180_06300
   00626 Naphthalene degradation
    LY180_06300
Enzymes [BR:ecol01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     LY180_06300
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     LY180_06300
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fe-ADH HTH_AsnC-type DUF4158
Motif
Other DBs
NCBI-GeneID: 16978933
NCBI-ProteinID: AGW11519
Position
complement(1335989..1336492)
Genome map
AA seq 167 aa AA seqDB search
MAHKLGSQFHIPHGLANALLICNVIRYNANDNPTKQTAFSQYDRPQARRRYAEIADHLGL
SAPGDRTAAKIEKLLAWLETLKAELGIPKSIREAGVQEADFLANVDKLSEDAFDDQCTGA
NPRYPLISELKQILLDTYYGRDYVEGETAAKKEAAPAKAEKKAKKSA
NT seq 504 nt NT seq  +upstreamnt  +downstreamnt
atggcgcacaaactgggttcccagttccatattccgcacggtctggcaaacgccctgctg
atttgtaacgttattcgctacaatgcgaacgacaacccgaccaagcagactgcattcagc
cagtatgaccgtccgcaggctcgccgtcgttatgctgaaattgccgaccacttgggtctg
agcgcaccgggcgaccgtactgctgctaagatcgagaaactgctggcatggctggaaacg
ctgaaagctgaactgggtattccgaaatctatccgtgaagctggcgttcaggaagcagac
ttcctggcgaacgtggataaactgtctgaagatgcgttcgatgaccagtgcaccggcgct
aacccgcgttacccgctgatctccgagctgaaacagatcctgctggatacctactacggt
cgtgattatgtagaaggtgaaactgcagcgaaaaaagaagccgctccggctaaagctgag
aaaaaagcgaaaaaatccgcttaa

DBGET integrated database retrieval system