KEGG   Escherichia coli O145 H28 RM13514 (EHEC): ECRM13514_0465Help
Entry
ECRM13514_0465    CDS       T03010                                 

Gene name
phoA
Definition
Alkaline phosphatase (EC:3.1.3.1)
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
ecoo  Escherichia coli O145:H28 RM13514 (EHEC)
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Brite
KEGG Orthology (KO) [BR:ecoo00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    ECRM13514_0465 (phoA)
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    ECRM13514_0465 (phoA)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    ECRM13514_0465 (phoA)
Enzymes [BR:ecoo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     ECRM13514_0465 (phoA)
Exosome [BR:ecoo04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   ECRM13514_0465 (phoA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
Position
complement(506103..507560)
Genome map
AA seq 485 aa AA seqDB search
MFLFFNVFVHGENKVKQSTIALALLPLLFTPVTKARTPEMPVLENRAAQGDITAPGGARR
LTGDQTAALRDSLSDKPAKNIILLIGDGMGDSEITAARNYAEGAGGFFKGIDALPLTGQY
THYALNKKTGKPDYVTDSAASATAWSTGVKTYNGALGVDIHEKDHPTILEMAKAAGLATG
NVSTAELQDATPAALVAHVTSRKCYGPSATSEKCPGNALEKGGKGSITEQLLNARADVTL
GGGAKTFAETATAGEWQGKTLREQAQARGYQLVSDAASLNSVTEANQQKPLLGLFADGNM
PVRWLGPKATYHGNIDKPAVTCTPNPQRNDSVPTLAQMTDKAIELLSKNEKGFFLQVEGA
SIDKQDHAANPCGQIGETVDLDEAVQRALEFAKKEGNTLVIVTADHAHASQIVAPDTKAP
GLSQALNTKDGAVMVMSYGNSEEDSQEHTGSQLRIAAYGPHAANVVGLTDQTDLFYTMKA
ALGLK
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
ttgtttttattttttaatgtatttgtacatggagaaaataaagtgaaacaaagcactatt
gcactggcactcttaccgttactgtttacccctgtgacaaaagcccggacaccagaaatg
cctgttctggaaaaccgggctgctcagggcgatattactgcacccggcggtgctcgccgc
ttaacgggtgatcagaccgccgctctgcgtgattctcttagcgataaacctgcaaaaaat
attattttgctgattggcgatgggatgggggattcggaaattactgccgcacgtaattat
gccgaaggtgcgggcggcttttttaaaggtatcgatgccttaccgcttaccgggcaatac
actcactatgcgctgaataaaaaaaccggcaaaccggactacgtcaccgactcggctgca
tcagcaaccgcctggtcaaccggtgtcaaaacctataacggcgcgctgggcgtcgatatt
cacgaaaaagatcacccaacgattctggaaatggcaaaagccgcaggtctggcgaccggt
aacgtttctaccgcagagttgcaggatgccacgcccgctgcgctggtggcacatgtgacc
tcgcgcaaatgctacggtccgagcgcgaccagtgaaaaatgtccgggtaacgctctggaa
aaaggcggaaaaggatcgattaccgaacagctgcttaacgctcgtgccgacgttacgctt
ggcggcggcgcaaaaacctttgctgaaacggcaaccgctggtgaatggcagggaaaaacg
ctgcgtgaacaggcacaggcgcgtggttatcagttggtgagcgatgctgcctcactgaat
tcggtgacggaagcgaatcagcaaaaacccctgcttggcctgtttgctgacggcaatatg
ccagtgcgctggctaggaccgaaagcaacgtatcacggtaatattgataagcccgcagtc
acctgtacgcctaatccgcaacgtaatgacagtgtaccaaccctggcgcagatgaccgac
aaagccattgaattgttgagtaaaaatgagaaaggctttttcctgcaagttgaaggtgcg
tcaatcgataaacaggatcatgctgcgaatccttgtgggcaaattggcgagacggtcgat
ctcgatgaagccgtacaacgggcgctggaattcgctaaaaaggagggtaacacgctggtc
atagtcaccgctgatcacgcccacgccagccagattgttgcgccggataccaaagctccg
ggcctctcccaggcgctaaataccaaagatggcgcagtgatggtgatgagttacgggaac
tccgaagaggattcacaagaacatacaggcagtcagttgcgtattgcggcgtatggcccg
catgccgccaatgttgttggactgaccgaccagactgatctcttctacaccatgaaagcc
gccctggggctgaaataa

DBGET integrated database retrieval system