KEGG   Escherichia coli O145 H28 RM13514 (EHEC): ECRM13514_3500Help
Entry
ECRM13514_3500    CDS       T03010                                 

Gene name
gapT
Definition
Gamma-aminobutyrate:alpha-ketoglutarate aminotransferase (EC:2.6.1.19)
Orthology
K07250  
4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase [EC:2.6.1.19 2.6.1.22]
Organism
ecoo  Escherichia coli O145:H28 RM13514 (EHEC)
Pathway
Alanine, aspartate and glutamate metabolism
Valine, leucine and isoleucine degradation
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Metabolic pathways
Module
GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:ecoo00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    ECRM13514_3500 (gapT)
   00650 Butanoate metabolism
    ECRM13514_3500 (gapT)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    ECRM13514_3500 (gapT)
   00280 Valine, leucine and isoleucine degradation
    ECRM13514_3500 (gapT)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    ECRM13514_3500 (gapT)
Enzymes [BR:ecoo01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     ECRM13514_3500 (gapT)
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     ECRM13514_3500 (gapT)
Amino acid related enzymes [BR:ecoo01007]
 Aminotransferase (transaminase)
  Class III
   ECRM13514_3500 (gapT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
Position
3410647..3411927
Genome map
AA seq 426 aa AA seqDB search
MSSNKELMQRRSQAVPRGVGQIHPIFADRAENCRVWDVEGREYLDFAGGIAVLNTGHLHP
KVVAAVEAQLKKLSHTCFQVLAYEPYLELCEIMNQKVPGDFAKKTLLVTTGSEAVENAVK
IARAATKRSGTIAFSGAYHGRTHYTLALTGKVNPYSAGMGLMPGHVYRALYPCPLHGISE
DDAIASIHRIFKNDAAPEDIAAIVIEPVQGEGGFYAATPAFMQRLRALCDEHGIMLIADE
VQSGAGRTGTLFAMEQMGVAPDLTTFAKSIAGGFPLAGVTGRAEVMDAVAPGGLGGTYAG
NPIACVAALEVLKVFEQENLLQKANVLGQKLKDGLLAIAEKHPEIGDVRGLGAMIAIELF
EDGDHSKPDAKLTAEIVARARDKGLILLSCGPYYNVLRILVPLTIEDAQIRQGLEIISQC
FDEAKQ
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgagcagcaataaagagttaatgcagcgccgtagtcaggcagttcctcgtggcgttggg
caaattcaccccattttcgctgatcgcgcagaaaactgccgggtgtgggacgttgaaggc
cgtgagtatcttgatttcgcgggcggcattgcggtgctcaataccgggcacctgcatccg
aaagtggttgcggcggtggaagcgcagttgaaaaaattgtcgcacacctgcttccaggtg
ctggcttacgagccgtatctggagctgtgcgagattatgaatcagaaggtgccgggcgat
tttgccaagaaaacgctgctggttacgaccggttccgaagcggtggaaaacgcggtgaaa
atcgcccgcgcagccaccaaacgtagcggcaccatcgcttttagcggcgcgtatcacggg
cgcacgcattacacgctggcgctgaccggcaaggtgaatccatactctgcgggcatgggc
ctgatgccagggcacgtttatcgcgcgctttatccttgcccgctgcacggtatcagtgaa
gatgacgctatcgccagcatccaccgaatttttaaaaatgacgctgcgccggaagatatc
gccgccatcgtgattgagccggttcagggcgaaggcggtttctacgccgcgacgcctgct
tttatgcagcgtttacgcgcgctgtgtgacgagcacgggatcatgctgattgccgatgaa
gtgcagagcggcgcggggcgtaccggcacgctgtttgcgatggagcaaatgggcgtggca
ccggatctcaccacctttgcgaaatcgatcgcaggcggcttcccgctggcgggcgtcacc
gggcgcgccgaagtgatggatgccgtcgctccaggcgggctgggcggcacctatgccggt
aatccgattgcctgcgtggctgcgctggaagtgttgaaggtgttcgagcaggaaaatctg
ctgcaaaaagccaacgttctggggcagaagttgaaagacggattgctggcgatagccgaa
aaacacccggagatcggcgacgtacgcgggctgggagcgatgatcgccatcgagctgttt
gaagatggcgatcacagcaaaccggacgcaaaactcaccgccgagatcgtggcgcgcgcc
cgcgataagggcctgattcttctctcctgcggcccgtattacaacgtgctacgcatcctt
gtaccactcaccattgaagacgctcagatccgtcagggtctggagatcatcagccagtgt
tttgatgaggcgaagcagtag

DBGET integrated database retrieval system