KEGG   Escherichia coli O145 H28 RM13514 (EHEC): ECRM13514_4814Help
Entry
ECRM13514_4814    CDS       T03010                                 

Gene name
rbsK
Definition
Ribokinase (EC:2.7.1.15)
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
ecoo  Escherichia coli O145:H28 RM13514 (EHEC)
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:ecoo00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    ECRM13514_4814 (rbsK)
Enzymes [BR:ecoo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     ECRM13514_4814 (rbsK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
Position
4702755..4703699
Genome map
AA seq 314 aa AA seqDB search
MDIPNMQNAGSLVVLGSINADHILNLHSFPTPGETVTGNHYQVAFGGKGANQAVAAGRSG
ANIAFIACTGDDSIGESVRQQLATDNIDITPVSVIKGESTGVALIFVNGEGENVIGIHAG
ANAALSPVLVEAQRERIANASALLMQLESPLESVMAAAKIAHQNKTIVALNPAPARELPD
ELLALVDIITPNETEAEKLTGIRVENDEDAAKAAQVLHEKGIRTVLITLGSRGVWASVNG
EGQRVPGFRVQAVDTIAAGDTFNGALITALLEEKPLPEAIRFAHAAAAIAVTRKGAQPSV
PWREEIDAFLDRQR
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atggacatcccgaatatgcaaaacgcaggcagcctcgttgttcttggcagcattaatgct
gaccatatccttaatcttcactcttttcctactccaggcgaaaccgtaaccggtaaccac
tatcaagttgcatttggcggcaaaggcgcaaatcaggctgtggctgctgggcgtagcggt
gcgaatatcgcgtttattgcctgcactggcgatgacagtattggcgagagtgttcgccag
cagctcgccactgataacatcgatattactccggtcagcgtgatcaaaggcgaatcaaca
ggtgtggcgctgatttttgttaatggcgaaggtgagaatgtcattggtattcatgccggc
gctaatgctgccctttccccggtgctggtggaagcgcaacgtgagcgtattgccaacgcg
tcagcattattaatgcagctggaatcaccactcgaaagtgtgatggcagcggcgaaaatc
gcccatcaaaataagactatcgttgcgcttaacccggctccggctcgcgaacttcctgac
gaactgctggcgctggtggacattattacgccaaacgaaacggaagcagaaaagctcacc
ggtattcgtgttgaaaatgatgaagatgcagcgaaggcggcgcaggtactgcatgaaaaa
ggtatccgtactgtactgattactttaggaagtcgtggtgtatgggctagcgtgaatggc
gaaggtcagcgtgttcctggattccgggtgcaggctgtcgataccattgcagccggagat
acctttaacggcgcgttaatcacggcgttgctggaagaaaaaccgttgccagaggctatt
cgttttgctcatgccgccgctgcgattgccgtaacgcgtaaaggcgcacaaccttccgta
ccgtggcgtgaagagatcgacgcatttttagacaggcagaggtga

DBGET integrated database retrieval system