KEGG   Escherichia coli O6 K15 H31 536 (UPEC): ECP_0087Help
Entry
ECP_0087          CDS       T00373                                 

Gene name
murE
Definition
UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate ligase (EC:6.3.2.13)
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
ecp  Escherichia coli O6:K15:H31 536 (UPEC)
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Class
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:ecp00300]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:ecp00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
94484..95971
Genome map
AA seq 495 aa AA seqDB search
MADRNLRDLLAPWVPDAPSRALREMTLDSRVAAAGDLFVAVVGHQADGRRYIPQAIAQGV
AAIIAEAKDEATDGEIREMHGVPVIYLSQLNERLSALAGRFYHEPSDNLRLVGVTGTNGK
TTTTQLLAQWSQLLGETSAVMGTVGNGLLGKVIPTENTTGSAVDVQHELAGLVDQGATFC
AMEVSSHGLVQHRVAALKFAASVFTNLSRDHLDYHGDMEHYEAAKWLLYSAHHCGQAIIN
ADDEVGRRWLAKLPDAVAVSMEDHINPNCHGRWLKATDVNYHDSGATIRFSSSWGDGEIE
SRLMGAFNVSNLLLALATLLALGYPLADLLKTAARLQPVCGRMEVFTAPGKPTVVVDYAH
TPDALEKALQAARLHCAGKLWCVFGCGGDRDKGKRPLMGAIAEEFADVAVVTDDNPRTEE
PRAIINDILAGMLDAGYAKVMEGRAEAVTCAVMQAKENDVVLVAGKGHEDYQIVGNQRLD
YSDRVTVARLLGVIA
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
gtggcagatcgtaatttgcgcgaccttcttgctccgtgggtgccagacgcaccttcgcga
gcactgcgagagatgacactcgacagccgtgtggctgcggcgggcgatctctttgtagct
gtagtaggtcatcaggcggacgggcgtcgatatatcccgcaggcgatagcgcaaggtgtg
gctgccattattgcagaggcgaaagatgaggcgaccgacggtgaaatccgtgaaatgcac
ggcgtaccggtcatctatctcagccagctcaacgagcgtttatctgcactggcgggccgc
ttttaccatgaaccctctgacaatttacgtctcgtgggcgtaacgggcaccaacggcaaa
accacgactacccagctgttggcgcagtggagccaactgcttggcgaaaccagcgcggta
atgggcaccgttggtaacggcctgctggggaaagtgatcccgacagaaaatacaaccggt
tcggcagtcgatgttcagcatgagctggcggggctggtggatcagggcgcgactttttgc
gcaatggaagtttcatcccacgggctggtacaacaccgtgtggcggcattgaaatttgcg
gcgtcggtctttaccaacttaagccgcgatcaccttgattatcatggtgatatggaacac
tacgaagccgcgaaatggctgctttattctgcacatcattgcggtcaggcgattattaac
gccgacgatgaagtgggccgccgctggctggcaaaactgccggacgcggttgcggtatca
atggaagatcatatcaatccgaactgtcacggacgctggttgaaagcgaccgacgtgaac
tatcacgacagcggtgcgaccattcgctttagctcgagttggggcgatggggaaattgaa
agtcgcctgatgggcgcattcaacgtcagcaacctgctgctggcgctggcgacactgctg
gcactcggctatccgctggctgatttgctgaaaaccgccgcgcgtctgcaaccggtttgc
ggacgtatggaagtgttcactgcaccaggcaaaccgacggtggtggtggattacgcgcat
acgccggatgcactggaaaaagccttacaggcggcgcgcctgcactgtgcaggcaagctg
tggtgcgtctttggctgcggtggcgatcgtgataaaggcaaacgtccactgatgggcgca
attgctgaagagtttgctgacgtggcggtggtgacggacgataacccgcgtaccgaagag
cctcgtgccatcatcaacgatattctggcgggaatgttagatgccggatatgccaaagtg
atggaaggccgtgctgaagcggtgacttgcgccgttatgcaggctaaagagaatgatgtg
gtactggtcgcgggcaaaggccatgaggattaccagattgttggcaatcagcgtctggac
tactccgatcgcgtcacggtggcgcgtctgctgggggtgattgcatga

DBGET integrated database retrieval system