KEGG   Escherichia coli O6 K15 H31 536 (UPEC): ECP_0152Help
Entry
ECP_0152          CDS       T00373                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase (EC:2.7.6.3)
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
ecp  Escherichia coli O6:K15:H31 536 (UPEC)
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:ecp00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    ECP_0152
Enzymes [BR:ecp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     ECP_0152
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(162702..163181)
Genome map
AA seq 159 aa AA seqDB search
MTVAYIAIGSNLASPLEQVNAALKALGDIPESRILAVSSFYRTPPLGPQDQPDYLNAAVA
LETTLAPEELLNHTQRIELQQGRVRKAERWGPRTLDLDIMLFGNEVINTERLTVPHYDMK
NRGFMLWPLFEIAPELVFPDGLSLVEALQAKGFNELDKW
NT seq 480 nt NT seq  +upstreamnt  +downstreamnt
atgacagtggcgtatattgccataggcagcaatctggcctctccgctggagcaggtcaat
gctgccctgaaagcattaggcgatattccagaaagccgcattcttgctgtttcttcgttt
taccgcaccccaccgctggggccgcaagatcaacccgattacttaaatgccgccgtcgcg
ctggaaaccactcttgcccctgaagagctactcaatcacacacaacgtatcgaattgcag
caaggtcgcgtccgtaaagctgaacgctggggaccgcgcacgctggatctcgacatcatg
ctgtttggtaatgaagtaataaataccgaacgtctgaccgtaccgcactacgatatgaaa
aatcgtggctttatgctgtggccactgtttgaaattgcgccggaattggtatttcctgat
ggcttatcattagttgaagctctacaggcaaaaggctttaatgaattagataagtggtaa

DBGET integrated database retrieval system