KEGG   Escherichia coli O6 K15 H31 536 (UPEC): ECP_0560Help
Entry
ECP_0560          CDS       T00373                                 

Definition
multifunctional acyl-CoA thioesterase I/protease I/lysophospholipase L1 (EC:3.1.2.-)
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
ecp  Escherichia coli O6:K15:H31 536 (UPEC)
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:ecp00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    ECP_0560
Enzymes [BR:ecp01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     ECP_0560
   3.1.2  Thioester hydrolases
    3.1.2.-  
     ECP_0560
Lipid biosynthesis proteins [BR:ecp01004]
 Fatty acid synthase
  Component type
   ECP_0560
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(589003..589659)
Genome map
AA seq 218 aa AA seqDB search
MLPVTDGLLKMMNFNNVFRWHLPFLFLVLLTFRAAAADTLLILGDSLSAGYRMSASAAWP
ALLNDKWQSKTSVVNASISGDTSQQGLARLPALLKQHQPRWVLVELGGNDGLRGFQPQQT
EQTLRQILQDVKAANAEPLLMQIRLPANYGRRYNEAFSAIYPKLAKEFDVPLLPFFMEEV
YLKPQWMQDDGIHPNRDAQPFIADWMAKQLQPLVNHDS
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atgctccccgtgaccgacggacttcttaagatgatgaacttcaacaatgttttccgctgg
catttgcccttcctgttcctggtcctgttaaccttccgtgccgccgcagcggacacgtta
ttgattctgggtgatagcctgagcgccgggtatcgaatgtctgccagcgcggcctggcct
gccttgttgaatgataagtggcagagtaaaacgtcggtagtcaatgccagcatcagcggc
gacacctcgcaacaagggctggcgcgccttccggctctgctgaaacagcatcagccgcgc
tgggtgctggttgaactgggcggcaatgacggtttgcgtggttttcaaccacagcaaacc
gagcaaacgctgcgccagattttgcaggatgtcaaagccgccaacgctgaaccattgtta
atgcaaatacgtctgcctgcaaactatggtcgccgttataatgaagcctttagcgccatt
taccccaaactcgccaaagagtttgatgttccgctgctgcccttttttatggaagaggtc
tacctcaagccacaatggatgcaggatgacggtattcatcccaaccgcgacgcccagccg
tttattgccgactggatggcgaagcagttgcagcctttagtaaatcatgactcataa

DBGET integrated database retrieval system