KEGG   Escherichia coli O6 K15 H31 536 (UPEC): ECP_0611Help
Entry
ECP_0611          CDS       T00373                                 

Definition
membrane protein YbdJ
Organism
ecp  Escherichia coli O6:K15:H31 536 (UPEC)
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(643428..643676)
Genome map
AA seq 82 aa AA seqDB search
MKHPLETLTTAAGILLMAFLSCLLLPAPALGLTLAQKLVTTFHLMDLSQLYTVLFCLWFL
VLGAIEYFVLRFIWRRWFSLAD
NT seq 249 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaccctttagaaaccttgaccaccgcagcaggcattttgctgatggctttcctc
tcttgcctgctgctgcccgcccccgcactggggctgacgctggcacaaaaactggtgacc
acgttccatctgatggatcttagccagctttacactgtattgttttgtctgtggttttta
gtgctgggcgctattgagtattttgttctacgctttatctggcgacgctggttctcgctg
gcggattaa

DBGET integrated database retrieval system