KEGG   Escherichia coli O6 K15 H31 536 (UPEC): ECP_0686Help
Entry
ECP_0686          CDS       T00373                                 

Gene name
asnB
Definition
asparagine synthetase B (EC:6.3.5.4)
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
ecp  Escherichia coli O6:K15:H31 536 (UPEC)
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ecp00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    ECP_0686 (asnB)
Enzymes [BR:ecp01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     ECP_0686 (asnB)
Peptidases [BR:ecp01002]
 Cysteine Peptidases
  Family C44
   ECP_0686 (asnB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(723914..725578)
Genome map
AA seq 554 aa AA seqDB search
MCSIFGIFDIKTDAVELRKKALELSRLMRHRGPDWSGIYASDNAILAHERLSIVDVNAGA
QPLYNQQKTHVLAVNGEIYNHQALRAEYGDRYQFQTGSDCEVILALYQEKGPEFLDDLQG
MFAFALYDSEKDAYLIGRDHLGIIPLYMGYDEHGQLYVASEMKALVPVCRTIKEFPAGSY
LWSQDGEIRSYYHRDWFDYDAVKDNVTDKNELRQALEDSVKSHLMSDVPYGVLLSGGLDS
SIISAITKKYAARRVEDQERSEAWWPQLHSFAVGLPGSPDLKAAQEVANHLGTVHHEIHF
TVQEGLDAIRDVIYHIETYDVTTIRASTPMYLMSRKIKAMGIKMVLSGEGSDEVFGGYLY
FHKAPNAKELHEETVRKLLALHMYDCARANKAMSAWGVEARVPFLDKKFLDVAMRINPQD
KMCGNGKMEKHILRECFEAYLPASVAWRQKEQFSDGVGYSWIDTLKEVAAQQVSDQQLET
ARFRFPYNTPTSKEAYLYREIFEELFPLPSAAECVPGGPSVACSSAKAIEWDEAFKKMDD
PSGRAVGVHQSAYK
NT seq 1665 nt NT seq  +upstreamnt  +downstreamnt
atgtgttcaatttttggcatattcgatatcaaaacagacgcagttgagctgcgtaagaaa
gcactcgagctgtcacgcctgatgcgtcatcgtggcccggactggtccggcatttatgcc
agcgataacgccattctcgcccacgaacgtctgtcaattgttgacgttaacgcgggggcg
caacctctctacaaccaacaaaaaactcatgtgctggcagtaaacggtgaaatctacaac
caccaggcattgcgcgctgaatatggcgatcgttaccagttccagaccgggtctgactgt
gaagtgatcctcgcgctgtatcaggaaaaagggccggaatttctcgacgacttgcagggc
atgtttgcctttgccctgtacgacagcgaaaaagatgcatatctgattggtcgcgaccat
ctggggatcatcccactgtatatgggctatgacgaacacggtcagctgtatgtggcctca
gaaatgaaagccctcgtgccagtttgccgcacgattaaagagtttccggcggggagctat
ttgtggagtcaggacggcgaaatccgttcttattatcatcgcgactggttcgactacgat
gcggtgaaagataacgtgaccgacaaaaacgagctgcgtcaggcactggaagattccgtt
aaaagccatctgatgtctgatgtgccttacggtgtgctgctttctggtggtctggattcc
tcaattatttccgctatcaccaagaaatacgccgcccgccgcgtggaagatcaggaacgc
tctgaagcctggtggccgcagttgcactcctttgctgtaggtctgccgggctcaccggat
ctgaaagcagcccaggaagtggcaaaccatctgggcacggtgcatcacgaaattcacttc
actgtacaggaaggtctggatgccatccgcgacgtgatttaccacatcgaaacttatgat
gtgaccactattcgcgcttcaacaccgatgtatttaatgtcgcgtaagatcaaggcgatg
ggcattaaaatggtgctgtccggtgaaggttctgacgaagtgtttggcggttatctatac
ttccacaaagcgccgaacgctaaagagttgcatgaagagacggtgcgtaaactgctggcc
ctgcatatgtatgactgcgcgcgtgccaacaaagcgatgtcagcctggggcgtggaagca
cgcgttccgttcctcgacaaaaaattccttgatgtggcgatgcgcattaacccacaggat
aaaatgtgcggtaacggcaaaatggaaaaacacatcctgcgtgaatgttttgaagcgtat
ctgcctgcaagcgtggcctggcggcaaaaagagcagttctccgatggcgtcggttacagt
tggatcgacaccctgaaagaagtggcagcgcagcaggtttctgatcaacagctggaaact
gcccgcttccgcttcccgtacaacacgccgacctcaaaagaagcgtatctgtaccgggag
atctttgaagaattgttcccgcttccgagcgccgctgagtgcgtgccgggcggtccttcc
gtcgcttgttcttccgctaaagcgattgagtgggatgaagcgttcaagaaaatggacgat
ccgtctggtcgcgcggttggcgttcaccagtcggcatataaataa

DBGET integrated database retrieval system